Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|023290
Gene name
Locationscaffold_11:485586..490680
Strand-
Gene length (bp)5094
Transcript length (bp)3054
Coding sequence length (bp)3054
Protein length (aa) 1018

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01822 WSC WSC domain 8.2E-19 52 132
PF01822 WSC WSC domain 7.2E-18 162 243
PF01822 WSC WSC domain 8.8E-17 283 363
PF01822 WSC WSC domain 6.8E-14 394 477
PF07250 Glyoxal_oxid_N Glyoxal oxidase N-terminus 3.2E-25 554 755
PF09118 GO-like_E_set Galactose oxidase-like, Early set domain 4.1E-23 900 996

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 155 1017 0.0E+00
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 18 362 1.0E-50
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 45 252 9.0E-30
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 44 250 7.0E-25
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 163 372 4.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 155 1017 0.0E+00
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 18 362 1.0E-50
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 45 252 9.0E-30
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 44 250 7.0E-25
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 163 372 4.0E-24
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 41 252 1.0E-20
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 163 370 2.0E-19
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 302 486 7.0E-18
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 281 485 1.0E-16
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 283 549 2.0E-15
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 142 386 2.0E-14
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 252 556 2.0E-14
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 52 251 2.0E-14
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 282 556 3.0E-14
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 47 251 4.0E-14
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 252 556 4.0E-14
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 52 256 5.0E-14
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 24 243 2.0E-12
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 47 278 3.0E-11
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 47 214 6.0E-11
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 283 560 3.0E-10
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 146 334 5.0E-10
sp|Q5QQ53|XYLT_DROPS Xylosyltransferase oxt OS=Drosophila pseudoobscura pseudoobscura GN=oxt PE=2 SV=1 51 143 8.0E-10
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 146 386 1.0E-09
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 162 334 2.0E-09
sp|Q7KVA1|XYLT_DROME Xylosyltransferase oxt OS=Drosophila melanogaster GN=oxt PE=2 SV=1 51 143 2.0E-09
sp|Q99N43|KREM1_MOUSE Kremen protein 1 OS=Mus musculus GN=Kremen1 PE=2 SV=2 45 140 5.0E-09
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 52 147 5.0E-09
sp|Q924S4|KREM1_RAT Kremen protein 1 OS=Rattus norvegicus GN=Kremen1 PE=2 SV=1 45 140 6.0E-09
sp|Q7KVA1|XYLT_DROME Xylosyltransferase oxt OS=Drosophila melanogaster GN=oxt PE=2 SV=1 160 251 6.0E-09
sp|I1S2N3|GAOA_GIBZE Galactose oxidase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GAOA PE=3 SV=1 788 996 9.0E-09
sp|P0CS93|GAOA_GIBZA Galactose oxidase OS=Gibberella zeae GN=GAOA PE=1 SV=1 788 996 1.0E-08
sp|Q96MU8|KREM1_HUMAN Kremen protein 1 OS=Homo sapiens GN=KREMEN1 PE=2 SV=3 45 140 1.0E-08
sp|Q5QQ53|XYLT_DROPS Xylosyltransferase oxt OS=Drosophila pseudoobscura pseudoobscura GN=oxt PE=2 SV=1 160 251 3.0E-08
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 283 445 7.0E-08
sp|Q8NCW0|KREM2_HUMAN Kremen protein 2 OS=Homo sapiens GN=KREMEN2 PE=2 SV=1 162 253 1.0E-07
sp|Q5QQ53|XYLT_DROPS Xylosyltransferase oxt OS=Drosophila pseudoobscura pseudoobscura GN=oxt PE=2 SV=1 396 484 2.0E-07
sp|Q8K1S7|KREM2_MOUSE Kremen protein 2 OS=Mus musculus GN=Kremen2 PE=1 SV=1 162 253 3.0E-07
sp|Q7KVA1|XYLT_DROME Xylosyltransferase oxt OS=Drosophila melanogaster GN=oxt PE=2 SV=1 396 484 8.0E-07
sp|Q90Y90|KREM1_XENLA Kremen protein 1 OS=Xenopus laevis GN=kremen1 PE=2 SV=1 45 142 8.0E-07
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 45 141 1.0E-06
sp|Q8NCW0|KREM2_HUMAN Kremen protein 2 OS=Homo sapiens GN=KREMEN2 PE=2 SV=1 415 484 1.0E-06
sp|Q5QQ52|XYLT_CAEBR Xylosyltransferase sqv-6 OS=Caenorhabditis briggsae GN=sqv-6 PE=2 SV=1 396 477 2.0E-06
sp|Q90Y90|KREM1_XENLA Kremen protein 1 OS=Xenopus laevis GN=kremen1 PE=2 SV=1 161 251 2.0E-06
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 391 484 3.0E-06
sp|Q8K1S7|KREM2_MOUSE Kremen protein 2 OS=Mus musculus GN=Kremen2 PE=1 SV=1 415 484 6.0E-06
sp|Q96MU8|KREM1_HUMAN Kremen protein 1 OS=Homo sapiens GN=KREMEN1 PE=2 SV=3 161 251 8.0E-06
sp|Q8NCW0|KREM2_HUMAN Kremen protein 2 OS=Homo sapiens GN=KREMEN2 PE=2 SV=1 283 370 9.0E-06
sp|Q99N43|KREM1_MOUSE Kremen protein 1 OS=Mus musculus GN=Kremen1 PE=2 SV=2 161 251 9.0E-06
sp|Q8K1S7|KREM2_MOUSE Kremen protein 2 OS=Mus musculus GN=Kremen2 PE=1 SV=1 37 140 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 530.52 210.66 850.38
Initials Initials knots 776.05 239.40 1312.70
Pileal_Stipeal_center Stage I stipe center 588.66 220.18 957.14
Pileal_Stipeal_shell Stage I stipe shell 154.20 82.33 226.06
DIF_stipe_center Stage II stipe center 700.75 242.17 1159.33
DIF_stipe_shell Stage II stipe shell 455.07 188.27 721.88
DIF_stipe_skin Stage II stipe skin 373.18 153.64 592.72
DIF_cap_skin Stage II cap skin 23.10 13.75 32.44
DIF_cap_tissue Stage II cap tissue 99.13 45.23 153.03
DIF_gill_tissue Stage II gill tissue 246.87 113.22 380.52
YFB_stipe_center Young fruiting body stipe center 825.44 206.90 1443.98
YFB_stipe_shell Young fruiting body stipe shell 654.76 233.79 1075.73
YFB_stipe_skin Young fruiting body stipe skin 289.58 138.23 440.92
YFB_cap_skin Young fruiting body cap skin 15.14 8.80 21.48
YFB_cap_tissue Young fruiting body cap tissue 31.55 18.45 44.64
YFB_gill_tissue Young fruiting body gill tissue 118.36 46.27 190.45
YFB_veil Young fruiting body veil 180.38 56.18 304.57

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.046952 yes
Casing YFB_stipe_center 0.409533 no
Casing YFB_stipe_shell 0.744299 no
Casing YFB_stipe_skin 0.119615 no
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.011659 yes
Casing Initials 0.484796 no
Casing Pileal_Stipeal_center 0.886295 no
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.629173 no
Casing DIF_stipe_shell 0.815875 no
Casing DIF_stipe_skin 0.484796 no
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.005302 yes
DIF_gill_tissue YFB_stipe_shell 0.014081 yes
DIF_gill_tissue YFB_stipe_skin 0.789732 no
DIF_gill_tissue YFB_cap_skin 0.000613 yes
DIF_gill_tissue YFB_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_gill_tissue 0.069387 no
DIF_gill_tissue YFB_veil 0.571264 no
YFB_stipe_center YFB_stipe_shell 0.749518 no
YFB_stipe_center YFB_stipe_skin 0.014956 yes
YFB_stipe_center YFB_cap_skin 0.000613 yes
YFB_stipe_center YFB_cap_tissue 0.000613 yes
YFB_stipe_center YFB_gill_tissue 0.000613 yes
YFB_stipe_center YFB_veil 0.000613 yes
YFB_stipe_shell YFB_stipe_skin 0.042041 yes
YFB_stipe_shell YFB_cap_skin 0.000613 yes
YFB_stipe_shell YFB_cap_tissue 0.000613 yes
YFB_stipe_shell YFB_gill_tissue 0.000613 yes
YFB_stipe_shell YFB_veil 0.002951 yes
YFB_stipe_skin YFB_cap_skin 0.000613 yes
YFB_stipe_skin YFB_cap_tissue 0.000613 yes
YFB_stipe_skin YFB_gill_tissue 0.021056 yes
YFB_stipe_skin YFB_veil 0.318332 no
YFB_cap_skin YFB_cap_tissue 0.006032 yes
YFB_cap_skin YFB_gill_tissue 0.000613 yes
YFB_cap_skin YFB_veil 0.000613 yes
YFB_cap_tissue YFB_gill_tissue 0.000613 yes
YFB_cap_tissue YFB_veil 0.000613 yes
YFB_gill_tissue YFB_veil 0.437154 no
Initials DIF_gill_tissue 0.004548 yes
Initials YFB_stipe_center 0.947002 no
Initials YFB_stipe_shell 0.822132 no
Initials YFB_stipe_skin 0.017507 yes
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.000613 yes
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.657358 no
Initials Pileal_Stipeal_shell 0.000613 yes
Initials DIF_stipe_center 0.901200 no
Initials DIF_stipe_shell 0.282699 no
Initials DIF_stipe_skin 0.101705 no
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.024187 yes
Pileal_Stipeal_center YFB_stipe_center 0.581233 no
Pileal_Stipeal_center YFB_stipe_shell 0.894043 no
Pileal_Stipeal_center YFB_stipe_skin 0.065465 no
Pileal_Stipeal_center YFB_cap_skin 0.000613 yes
Pileal_Stipeal_center YFB_cap_tissue 0.000613 yes
Pileal_Stipeal_center YFB_gill_tissue 0.000613 yes
Pileal_Stipeal_center YFB_veil 0.004928 yes
Pileal_Stipeal_center Pileal_Stipeal_shell 0.000613 yes
Pileal_Stipeal_center DIF_stipe_center 0.802921 no
Pileal_Stipeal_center DIF_stipe_shell 0.664899 no
Pileal_Stipeal_center DIF_stipe_skin 0.335605 no
Pileal_Stipeal_center DIF_cap_skin 0.000613 yes
Pileal_Stipeal_center DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_shell DIF_gill_tissue 0.214014 no
Pileal_Stipeal_shell YFB_stipe_center 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.060104 no
Pileal_Stipeal_shell YFB_cap_skin 0.000613 yes
Pileal_Stipeal_shell YFB_cap_tissue 0.000613 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.595686 no
Pileal_Stipeal_shell YFB_veil 0.798245 no
Pileal_Stipeal_shell DIF_stipe_center 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_shell 0.003765 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.013186 yes
Pileal_Stipeal_shell DIF_cap_skin 0.000613 yes
Pileal_Stipeal_shell DIF_cap_tissue 0.244911 no
DIF_stipe_center DIF_gill_tissue 0.007092 yes
DIF_stipe_center YFB_stipe_center 0.834219 no
DIF_stipe_center YFB_stipe_shell 0.937016 no
DIF_stipe_center YFB_stipe_skin 0.024698 yes
DIF_stipe_center YFB_cap_skin 0.000613 yes
DIF_stipe_center YFB_cap_tissue 0.000613 yes
DIF_stipe_center YFB_gill_tissue 0.000613 yes
DIF_stipe_center YFB_veil 0.001140 yes
DIF_stipe_center DIF_stipe_shell 0.395814 no
DIF_stipe_center DIF_stipe_skin 0.152734 no
DIF_stipe_center DIF_cap_skin 0.000613 yes
DIF_stipe_center DIF_cap_tissue 0.000613 yes
DIF_stipe_shell DIF_gill_tissue 0.127784 no
DIF_stipe_shell YFB_stipe_center 0.227041 no
DIF_stipe_shell YFB_stipe_shell 0.502940 no
DIF_stipe_shell YFB_stipe_skin 0.301839 no
DIF_stipe_shell YFB_cap_skin 0.000613 yes
DIF_stipe_shell YFB_cap_tissue 0.000613 yes
DIF_stipe_shell YFB_gill_tissue 0.000613 yes
DIF_stipe_shell YFB_veil 0.029648 yes
DIF_stipe_shell DIF_stipe_skin 0.755363 no
DIF_stipe_shell DIF_cap_skin 0.000613 yes
DIF_stipe_shell DIF_cap_tissue 0.000613 yes
DIF_stipe_skin DIF_gill_tissue 0.369114 no
DIF_stipe_skin YFB_stipe_center 0.083158 no
DIF_stipe_skin YFB_stipe_shell 0.224708 no
DIF_stipe_skin YFB_stipe_skin 0.632966 no
DIF_stipe_skin YFB_cap_skin 0.000613 yes
DIF_stipe_skin YFB_cap_tissue 0.000613 yes
DIF_stipe_skin YFB_gill_tissue 0.001625 yes
DIF_stipe_skin YFB_veil 0.100894 no
DIF_stipe_skin DIF_cap_skin 0.000613 yes
DIF_stipe_skin DIF_cap_tissue 0.000613 yes
DIF_cap_skin DIF_gill_tissue 0.000613 yes
DIF_cap_skin YFB_stipe_center 0.000613 yes
DIF_cap_skin YFB_stipe_shell 0.000613 yes
DIF_cap_skin YFB_stipe_skin 0.000613 yes
DIF_cap_skin YFB_cap_skin 0.150303 no
DIF_cap_skin YFB_cap_tissue 0.329044 no
DIF_cap_skin YFB_gill_tissue 0.000613 yes
DIF_cap_skin YFB_veil 0.000613 yes
DIF_cap_skin DIF_cap_tissue 0.000613 yes
DIF_cap_tissue DIF_gill_tissue 0.011968 yes
DIF_cap_tissue YFB_stipe_center 0.000613 yes
DIF_cap_tissue YFB_stipe_shell 0.000613 yes
DIF_cap_tissue YFB_stipe_skin 0.002084 yes
DIF_cap_tissue YFB_cap_skin 0.000613 yes
DIF_cap_tissue YFB_cap_tissue 0.000613 yes
DIF_cap_tissue YFB_gill_tissue 0.776644 no
DIF_cap_tissue YFB_veil 0.181805 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|023290
MGLLTPTALALAIAFAPLTLSNAQATHRANHNVFRHRRQSIPTTLPGNWSSLGCYTDNVASGRTLNAAATASGDS
MTTESCINFCDSRGYMYAGTEYGAECYCDNYIKNDGSPTADAECNMRCTGNTLEPCGAGGRLNLFTSGGTPPAPP
TILLDIGNWVSLGCWTDAVNGAPRTLSVGMATDGPVTTESCTTACFEDGWRFAGTEFSHECYCGGSLNAASTQTP
DGDCNMACEGDSSEICGGPNRLSVYNYTGTDLPTNPGGGDNGGAVFPVLDDLPTGWAYNACWVDNAHGRIIQTLV
SDSPTMTVETCIQACDARNLTVAGLEFSTQCFCGSNLAAGPVLADESSCNMGCGGNTTEACGGPARTSVYTKGPL
TVFPVPTPLQDDLPGEFTYAGCLHEFDGGRILPWMLEWPTNNSATACMERCAEYGYPAAGVEFGIQCFCGDITDV
TDKNGVIGNEADCNIPCPGDPAHLCGGGGRLNYYTWQGDLNVWHEPAVTGWYEFFIPGVIVPLIATVGTNSKVTF
LEKHGTGFPNTTGAFEFDPSLSNDFSKAWRELQGVKTDVFCAGSVILPDKIGRQLNVGGWSLDSTYGVRLFTPNG
ELGTNSTGDWEEDYPSLKLQRGRWYPTASVLSNGSVLVLGGEIGSNDRAQPNLEVLPKPDGGDTVIELDWLARTD
PNNLYPFIVVLPSQNIFVGYWNEARILEPVNFDTIKELPNIPGNVNNFLAGRTYPLEGAAMPLPQHAPYTEPLEI
LICGGSTEGAGEASDNCVSLQPEAAEPKWIIERMPSKRVLSCMVALPDGTYMIMNGATQGIAGFGLANNPNLGAV
LYDPTLPRTQRMSILNNTIVARMYHSESILLPDGRVLVAGSDPQTNFDNGTVKYPEEFRVEVYVPHYLAAGQQQP
TFDLPEHDWSYNGQYTITNVHLFQGQTSGLRVSLIGASSSTHGNQMGARTIFPAVSCSGTTCTITAPPNAGICPP
GWFMLFVLDGSTPSVARWVRIGGDPSQMGNWPDMPGFTLPGL*
Coding >AgabiH97|023290
ATGGGTCTCTTGACTCCAACTGCGTTGGCTTTAGCCATCGCTTTCGCTCCTTTAACACTTTCCAATGCACAAGCC
ACGCATCGCGCAAACCACAACGTCTTCCGCCATCGCCGACAATCCATTCCTACCACTCTCCCAGGAAATTGGTCC
TCACTTGGCTGTTACACTGATAATGTCGCTTCCGGTCGCACGCTCAATGCTGCTGCCACCGCGAGTGGTGATTCT
ATGACCACCGAGTCCTGTATCAATTTTTGTGATTCAAGAGGTTACATGTATGCTGGAACAGAATACGGTGCCGAA
TGCTATTGCGATAACTATATCAAAAATGATGGTTCACCAACTGCAGATGCCGAATGCAATATGCGTTGTACCGGG
AATACGCTTGAACCATGTGGTGCTGGTGGTAGACTGAACTTGTTTACCAGTGGAGGTACTCCACCAGCCCCTCCG
ACTATCCTTCTGGATATCGGAAATTGGGTATCACTGGGTTGTTGGACTGATGCTGTCAATGGCGCGCCTCGTACT
TTATCCGTTGGTATGGCCACTGACGGACCGGTTACAACTGAGTCATGTACTACTGCATGTTTCGAAGATGGATGG
CGTTTCGCGGGAACGGAATTTTCTCATGAATGCTACTGTGGTGGCTCCCTCAATGCAGCCTCTACACAAACTCCA
GATGGAGATTGTAACATGGCTTGTGAAGGGGATAGTAGTGAAATCTGTGGTGGTCCGAATAGGTTGAGTGTTTAT
AACTACACCGGAACAGACCTTCCTACGAATCCCGGAGGAGGCGATAATGGCGGTGCTGTTTTCCCCGTTCTTGAC
GATCTGCCGACGGGATGGGCATATAATGCTTGCTGGGTGGACAATGCACATGGTCGTATTATACAAACCCTGGTT
TCGGATAGTCCCACTATGACGGTTGAAACATGTATTCAGGCTTGTGATGCTCGGAATCTCACCGTCGCTGGTCTT
GAATTTTCTACTCAATGCTTCTGCGGTTCTAACCTTGCAGCCGGTCCCGTATTGGCGGACGAATCTAGTTGCAAT
ATGGGATGCGGAGGCAACACTACTGAAGCTTGTGGTGGTCCAGCTCGGACTTCCGTTTACACCAAAGGTCCTTTG
ACTGTGTTCCCCGTCCCGACTCCCCTGCAAGATGATTTGCCTGGTGAATTCACCTATGCAGGCTGTTTGCATGAG
TTTGATGGCGGACGCATTCTACCTTGGATGCTTGAATGGCCGACTAATAATTCAGCAACTGCTTGTATGGAACGA
TGTGCGGAATATGGGTATCCTGCTGCGGGCGTTGAGTTCGGGATTCAATGTTTCTGTGGTGATATAACTGACGTC
ACTGATAAAAATGGTGTCATTGGTAACGAAGCGGATTGTAATATTCCTTGTCCGGGTGATCCGGCACATCTCTGT
GGTGGCGGTGGTCGCCTCAACTATTATACGTGGCAAGGTGATCTCAATGTTTGGCATGAACCCGCTGTCACTGGC
TGGTATGAGTTCTTCATTCCTGGTGTCATTGTTCCCTTGATCGCAACTGTCGGTACCAACTCCAAGGTTACCTTC
CTCGAGAAACATGGTACAGGTTTCCCCAACACTACCGGCGCATTTGAGTTTGATCCTAGTTTGTCCAATGACTTC
TCAAAGGCATGGCGTGAATTGCAAGGCGTGAAAACTGATGTATTCTGCGCCGGAAGTGTTATTTTACCTGACAAA
ATTGGAAGACAACTCAATGTTGGCGGATGGTCTCTCGATTCGACTTATGGTGTTCGTCTCTTTACTCCTAATGGT
GAACTTGGAACCAATTCGACTGGAGATTGGGAGGAAGATTATCCCAGTCTCAAGCTCCAGAGGGGTCGTTGGTAT
CCCACCGCTTCTGTTCTTTCTAATGGTTCTGTTCTTGTTCTTGGAGGAGAGATCGGCAGTAACGACCGGGCTCAG
CCAAATCTTGAAGTTTTACCTAAACCCGATGGTGGAGATACCGTTATTGAACTTGACTGGCTCGCGAGAACCGAT
CCCAATAACTTGTATCCTTTCATTGTTGTTCTTCCCAGTCAAAACATCTTCGTTGGATACTGGAATGAGGCTCGC
ATTTTAGAGCCAGTTAATTTTGACACAATCAAAGAACTGCCTAATATCCCCGGGAACGTCAATAATTTCCTCGCT
GGTCGTACATATCCTTTGGAGGGCGCAGCTATGCCCCTACCCCAACACGCTCCTTACACAGAGCCTTTGGAAATC
CTCATTTGCGGTGGTTCGACTGAAGGAGCAGGAGAGGCAAGTGATAATTGTGTTTCCCTTCAACCCGAGGCAGCC
GAACCTAAATGGATTATTGAACGCATGCCTTCGAAGCGCGTGCTCTCATGCATGGTTGCACTCCCGGATGGCACG
TACATGATTATGAACGGTGCTACTCAGGGCATTGCAGGATTCGGTTTGGCAAACAACCCTAATCTCGGCGCTGTC
TTGTATGATCCAACTCTTCCTCGCACTCAACGTATGTCGATCCTCAACAACACTATCGTCGCACGCATGTATCAT
TCGGAGTCAATTCTCCTGCCTGATGGACGTGTTCTTGTCGCGGGATCTGATCCCCAAACCAACTTTGATAATGGT
ACTGTGAAGTACCCCGAAGAGTTCCGCGTTGAGGTTTACGTTCCGCATTATCTCGCCGCTGGCCAGCAACAACCT
ACATTTGACCTTCCTGAGCATGACTGGTCTTATAACGGCCAATACACTATCACTAATGTTCATTTGTTCCAAGGC
CAAACGTCCGGATTACGTGTCTCATTGATTGGAGCTTCTTCGAGCACACATGGGAACCAGATGGGTGCTCGTACT
ATTTTCCCGGCCGTTTCTTGTAGTGGTACGACTTGCACGATCACTGCACCTCCTAATGCTGGTATCTGTCCTCCC
GGTTGGTTCATGCTCTTCGTGCTGGATGGTTCCACACCTTCTGTTGCTCGTTGGGTTCGTATTGGTGGTGACCCG
TCCCAAATGGGAAATTGGCCGGATATGCCTGGCTTTACGCTCCCGGGTCTCTAA
Transcript >AgabiH97|023290
ATGGGTCTCTTGACTCCAACTGCGTTGGCTTTAGCCATCGCTTTCGCTCCTTTAACACTTTCCAATGCACAAGCC
ACGCATCGCGCAAACCACAACGTCTTCCGCCATCGCCGACAATCCATTCCTACCACTCTCCCAGGAAATTGGTCC
TCACTTGGCTGTTACACTGATAATGTCGCTTCCGGTCGCACGCTCAATGCTGCTGCCACCGCGAGTGGTGATTCT
ATGACCACCGAGTCCTGTATCAATTTTTGTGATTCAAGAGGTTACATGTATGCTGGAACAGAATACGGTGCCGAA
TGCTATTGCGATAACTATATCAAAAATGATGGTTCACCAACTGCAGATGCCGAATGCAATATGCGTTGTACCGGG
AATACGCTTGAACCATGTGGTGCTGGTGGTAGACTGAACTTGTTTACCAGTGGAGGTACTCCACCAGCCCCTCCG
ACTATCCTTCTGGATATCGGAAATTGGGTATCACTGGGTTGTTGGACTGATGCTGTCAATGGCGCGCCTCGTACT
TTATCCGTTGGTATGGCCACTGACGGACCGGTTACAACTGAGTCATGTACTACTGCATGTTTCGAAGATGGATGG
CGTTTCGCGGGAACGGAATTTTCTCATGAATGCTACTGTGGTGGCTCCCTCAATGCAGCCTCTACACAAACTCCA
GATGGAGATTGTAACATGGCTTGTGAAGGGGATAGTAGTGAAATCTGTGGTGGTCCGAATAGGTTGAGTGTTTAT
AACTACACCGGAACAGACCTTCCTACGAATCCCGGAGGAGGCGATAATGGCGGTGCTGTTTTCCCCGTTCTTGAC
GATCTGCCGACGGGATGGGCATATAATGCTTGCTGGGTGGACAATGCACATGGTCGTATTATACAAACCCTGGTT
TCGGATAGTCCCACTATGACGGTTGAAACATGTATTCAGGCTTGTGATGCTCGGAATCTCACCGTCGCTGGTCTT
GAATTTTCTACTCAATGCTTCTGCGGTTCTAACCTTGCAGCCGGTCCCGTATTGGCGGACGAATCTAGTTGCAAT
ATGGGATGCGGAGGCAACACTACTGAAGCTTGTGGTGGTCCAGCTCGGACTTCCGTTTACACCAAAGGTCCTTTG
ACTGTGTTCCCCGTCCCGACTCCCCTGCAAGATGATTTGCCTGGTGAATTCACCTATGCAGGCTGTTTGCATGAG
TTTGATGGCGGACGCATTCTACCTTGGATGCTTGAATGGCCGACTAATAATTCAGCAACTGCTTGTATGGAACGA
TGTGCGGAATATGGGTATCCTGCTGCGGGCGTTGAGTTCGGGATTCAATGTTTCTGTGGTGATATAACTGACGTC
ACTGATAAAAATGGTGTCATTGGTAACGAAGCGGATTGTAATATTCCTTGTCCGGGTGATCCGGCACATCTCTGT
GGTGGCGGTGGTCGCCTCAACTATTATACGTGGCAAGGTGATCTCAATGTTTGGCATGAACCCGCTGTCACTGGC
TGGTATGAGTTCTTCATTCCTGGTGTCATTGTTCCCTTGATCGCAACTGTCGGTACCAACTCCAAGGTTACCTTC
CTCGAGAAACATGGTACAGGTTTCCCCAACACTACCGGCGCATTTGAGTTTGATCCTAGTTTGTCCAATGACTTC
TCAAAGGCATGGCGTGAATTGCAAGGCGTGAAAACTGATGTATTCTGCGCCGGAAGTGTTATTTTACCTGACAAA
ATTGGAAGACAACTCAATGTTGGCGGATGGTCTCTCGATTCGACTTATGGTGTTCGTCTCTTTACTCCTAATGGT
GAACTTGGAACCAATTCGACTGGAGATTGGGAGGAAGATTATCCCAGTCTCAAGCTCCAGAGGGGTCGTTGGTAT
CCCACCGCTTCTGTTCTTTCTAATGGTTCTGTTCTTGTTCTTGGAGGAGAGATCGGCAGTAACGACCGGGCTCAG
CCAAATCTTGAAGTTTTACCTAAACCCGATGGTGGAGATACCGTTATTGAACTTGACTGGCTCGCGAGAACCGAT
CCCAATAACTTGTATCCTTTCATTGTTGTTCTTCCCAGTCAAAACATCTTCGTTGGATACTGGAATGAGGCTCGC
ATTTTAGAGCCAGTTAATTTTGACACAATCAAAGAACTGCCTAATATCCCCGGGAACGTCAATAATTTCCTCGCT
GGTCGTACATATCCTTTGGAGGGCGCAGCTATGCCCCTACCCCAACACGCTCCTTACACAGAGCCTTTGGAAATC
CTCATTTGCGGTGGTTCGACTGAAGGAGCAGGAGAGGCAAGTGATAATTGTGTTTCCCTTCAACCCGAGGCAGCC
GAACCTAAATGGATTATTGAACGCATGCCTTCGAAGCGCGTGCTCTCATGCATGGTTGCACTCCCGGATGGCACG
TACATGATTATGAACGGTGCTACTCAGGGCATTGCAGGATTCGGTTTGGCAAACAACCCTAATCTCGGCGCTGTC
TTGTATGATCCAACTCTTCCTCGCACTCAACGTATGTCGATCCTCAACAACACTATCGTCGCACGCATGTATCAT
TCGGAGTCAATTCTCCTGCCTGATGGACGTGTTCTTGTCGCGGGATCTGATCCCCAAACCAACTTTGATAATGGT
ACTGTGAAGTACCCCGAAGAGTTCCGCGTTGAGGTTTACGTTCCGCATTATCTCGCCGCTGGCCAGCAACAACCT
ACATTTGACCTTCCTGAGCATGACTGGTCTTATAACGGCCAATACACTATCACTAATGTTCATTTGTTCCAAGGC
CAAACGTCCGGATTACGTGTCTCATTGATTGGAGCTTCTTCGAGCACACATGGGAACCAGATGGGTGCTCGTACT
ATTTTCCCGGCCGTTTCTTGTAGTGGTACGACTTGCACGATCACTGCACCTCCTAATGCTGGTATCTGTCCTCCC
GGTTGGTTCATGCTCTTCGTGCTGGATGGTTCCACACCTTCTGTTGCTCGTTGGGTTCGTATTGGTGGTGACCCG
TCCCAAATGGGAAATTGGCCGGATATGCCTGGCTTTACGCTCCCGGGTCTCTAA
Gene >AgabiH97|023290
ATGGGTCTCTTGACTCCAACTGCGTTGGCTTTAGCCATCGCTTTCGCTCCTGTGCGTTCCGTTCCCCGCGTCCAT
CATCGTTCGCTGGGCGACCTTCTGCTTTGTGCACGCGTACTGACAGCCTTCGTTCGCGTCTGTCCCCACGCTTTA
CTATACAGTTAACACTTTCCAATGCACAAGCCACGCATCGCGCAAACCACAACGTCTTCCGCCATCGCCGACAAT
CCATTCCTACCACTCTCCCAGGAAATTGGTCCTCACTTGGCTGTTACACGTACGTTGCGCTTATTCTTTATTTTC
CGAGCCGCTTCTTTTCTCGTCGGTCCTCCCCGCCCCCGTCGTGTTCTTTACATCACTTCCTTCTGCTTCTAGAGT
TAATTGAATTGAAGCTGACTCCTGTCGTTCACTTACCCTTTGCTATTTAGTGATAATGTCGCTTCCGGTCGCACG
CTCAATGCTGCTGCCACCGCGAGTGGTGATTCTATGACCACCGAGTCCTGTATCAATTTTTGTGATTCAAGAGGT
TACATGTATGCTGGAACAGAATACGGTGTAAGTGCCCGAGATTTTTTCGGTTCAGACTCTGCTTCTTTTCCTTTT
TCTTGGTATGCCCTGATTCCGAGCCTGGGATCGTATCAAATGAAAGTTTATCCGGGTTACTGTTCCGTGTGTCGT
CCGTCATCCTGGCGCGTCGCCTTATCTCCTCTTCCCCAATCTGAGACGTGGCAAAAATGTATTTACTAACGAAAC
TGTTCCTCTGTTCATTGCCAACATAGGCCGAATGCTGTACGTACCTTTTTTCCGGCCTCTCTTAATTCCGAAAGA
GCTGATCAAGATACCGTTTTTCCTCTTTGGCGCTTGGAACCTTTCTTCTGCTGTTCTCATCGTACCTTAACACAC
GACCTAAACTTACTTTCTTTGCTTATCCCTTCCTTTCTAAACGCCTTCTCTTCTTTGATTCTTACCTTCTTTGGC
ATACACCCTCTCCCACTAAAAAAACTTCCCGATTCTTTCGATATCTCCCACATCACTTCTATCTCCATCTATTCT
TTTTCTAATTCATCTACATGATTATCCTTATTCCTATTGATGCTACTCAAATTACTTCTCTTCTCTCCTCTTTCT
TCCTTTATCTCCTTATACTACTCGTCTTTTGCCATCATCTTTCCCCTTTCCCCCAATTTCTTCCTTTGAATCACA
GATTGCGATAACTATATCAAAAATGATGGTTCACCAACTGCAGATGCCGAATGCAATATGCGTTGTACCGGGAAT
ACGCTTGAACCATGTGGTGCTGGTGGTAGACTGAACTTGTTTACCAGTGGAGGTACTCCACCAGCCCCTCCGACT
ATCCTTCTGGATATCGGAAATTGGGTATCACTGGGTTGTTGGACGTAAGTTGACCCCTATCTTATATTTTAACCC
TTTGTTAATTTACTCTCCGTCCACTTTTGCTACCACCTTTCGACTTTACAGTGATGCTGTCAATGGCGCGCCTCG
TACTTTATCCGTTGGTATGGCCACTGACGGACCGGTTACAACTGAGTCATGTACTACTGCATGTTTCGAAGATGG
ATGGCGTTTCGCGGGAACGGAATTTTCTCAGTACGTGTGCCATCTACTTGACTGCCATTTCATCCATCAGAAACT
GTAAATTGACAAACATCACTTCTTTCGTCCATATAGTGAATGCTGTGAGTTTCTTGTCATTACCAAAAGCAAAAC
AAAAGCCGATAATGACGCTTGTAACCATTTGATTAGACTGTGGTGGCTCCCTCAATGCAGCCTCTACACAAACTC
CAGATGGAGATTGTAACATGGCTTGTGAAGGGGATAGTAGTGAAATCTGTGGTGGTCCGAATAGGTTGAGTGTTT
ATAACTACACCGGAACAGACCTTCCTACGAATCCCGGAGGAGGCGATAATGGCGGTGCTGTTTTCCCCGTTCTTG
ACGATCTGCCGACGGGATGGGCATATAATGCTTGCTGGGTGTAAGTTATCTATAACGAAGGTGCTTTCTTTTTCA
CTTGCTGAAAAATGGGATATTCGTTAGGGACAATGCACATGGTCGTATTATACAAACCCTGGTTTCGGATAGTCC
CACTATGACGGTTGAAACATGTATTCAGGCTTGTGATGCTCGGAATCTCACCGTCGCTGGTCTTGAATTTTCTAG
TAAGTCTTTTTCTTTTCTTTTGAAGTGGGAGTTCAATTTGGTTGACAATAATGTTTTAAGCTCAATGCTGTAGGT
CTCGTTGTGAGGCAGGTATATCTGGTTCACTGATGCATTTGCCACAGTCTGCGGTTCTAACCTTGCAGCCGGTCC
CGTATTGGCGGACGAATCTAGTTGCAATATGGGATGCGGAGGCAACACTACGTACGTCGTACTTTCGGTTCAATG
TCATGATACAAACTTTCTGATTGATGTCAATAGTGAAGCTTGTGGTGGTCCAGCTCGGACTTCCGTTTACACCAA
AGGTCCTTTGACTGTGTTCCCCGTCCCGACTCCCCTGCAAGATGATTTGCCTGGTGAATTCACCTATGCAGGCTG
TTTGCAGTGAGTTTTCAGTATCATTGTTACTGTTTTGACCAGAGTGTTGACGCATGCTCGTAGTGAGTTTGATGG
CGGACGCATTCTACCTTGGATGCTTGAATGGCCGACTAATAATTCAGCAACTGCTTGTATGGAACGATGTGCGGA
ATATGGGTATCCTGCTGCGGGCGTTGAGGTTGGTTTTTCTCTCTCTCTCTCAGTTATCAAATCATATCTAAAACT
CATGATTCGACTTTTGTAGTTCGGGATTCAATGTTGTACGTTCAGGGATTTGTTGGAGAGATTTTGCGTTATACT
GACTTGCGAAATACAGTCTGTGGTGATATAACTGACGTCACTGATAAAAATGGTGTCATTGGTAACGAAGCGGAT
TGTAATATTCCTTGTCCGGGTGATCCGGCACATCTCTGTGGTGGCGGTGGTCGCCTCAACTATTATACGTGGCAA
GGTGATCTCAATGTTTGGCATGAACCCGCTGTCACTGGCTGGTATGAGGTAAGTCATTTCATGTTGAAATTGGTG
GGGTGAGTATGAGACTGATTTATGTTTGTAGTTCTTCAGTGAGTATTCATTATGGGAAAGGCGCATTATCTATTT
TGATTTCTGATGATGTAACTTTATGATTACAGTTCCTGGGTAAGTGCGACTCGACTTTATATTTGAAATAAACTA
ACGTTTGACGCAGTGTCATTGTTCCCTTGATCGCAACTGTCGGTACCAACTCCAAGGTTACCTTCCTCGAGAAAC
ATGGTACAGGGTAAGATCCCTATCTCTTTCCGGTTTGATATCATATGAACAGATTGTATAGTTTCCCCAACACTA
CCGGCGCATTTGAGTTTGATCCTAGTTTGTCCAATGACTTCTCAAAGGCATGGCGTGAATTGCAAGGCGTGAAAA
CTGATGTATTCTGCGCCGGAAGTGTTATTTTACCTGACAAAATTGGAAGACAACTCAATGTTGGCGGATGGTCTC
TCGATTCGACTTATGGTGTTCGTCTCTTTACTCCTAATGGTGAACTTGGAACCAATTCGACTGGAGATTGGGAGG
AAGATTATCCCAGTCTCAAGCTCCAGGTTCGTGGCATTCACTCTTCTTTATTCTGTTGATTCTCTGTTGACAAGT
CAACTCCAGAGGGGTCGTTGGTATCCCACCGCTTCTGTTCTTTCTAATGGTTCTGTTCTTGTTCTTGGAGGAGAG
ATCGGCAGTAACGACCGGGCTCAGCCAAATCTTGAAGTTTTACCTAAACCCGATGGTGGAGATACCGTTATTGAA
CTTGACTGGCTCGCGAGAACCGATCCCAATAACTTGTATCCTTTCATTGTTGTTCTTCCCAGTCAAAACATCTTC
GTTGGTGCGTTACGTTTGTTTCAAAGCATTGTAATGGCCTTTACTCACGCGATTACTATAGGATACTGGAATGAG
GCTCGCATTTTAGAGCCAGTTAATTTTGACACAATCAAAGAACTGCCTAATATCCCCGGGAACGTCAATAATTTC
CTCGCTGGTCGTACATATCCTTTGGAGGGCGCAGCTATGCCCCTACCCCAACACGCTCCTTACACAGAGCCTTTG
GAAATCCTCATTTGCGGTGGTTCGACTGAAGGAGCAGGAGAGGCAAGTGATAATTGTGTTTCCCTTCAACCCGAG
GCAGCCGAACCTAAATGGATTATTGAACGCATGGTCAGCACCCCTCGCATTTTGGGTGTTTTGTGTACTAATGAA
TTCGTCATAGCCTTCGAAGCGCGTGCTCTCATGCATGGTTGCACTCCCGGATGGCACGTACATGATTATGAACGG
TGCTACTCAGGGCATTGCAGGATTCGGTTTGGCAAACAACCCTAATCTCGGCGCTGTCTTGTATGATCCAACTCT
TCCTCGCACTCAACGTATGTCGATCCTCAACAACACTATCGTCGCACGCATGTATCATTCGGAGTCAATTCTCCT
GCCTGATGGACGTGTTCTTGTCGCGGGATCTGATCCCCAAACCAACTTTGATAATGGTACTGTGAAGTACCCCGA
AGAGTTCCGCGTTGAGGTATGTTTTAAATTATGAAGTTCTTATTTCAAGTACTCATTATATAAAGGTTTACGTTC
CGCATTATCTCGCCGCTGGCCAGCAACAACCTACATTTGACCTTCCTGAGCATGACTGGTCTTATAACGGCCAAT
ACACTATCACTAATGTTCATTTGTTCCAAGGCCAAACGTCCGGATTACGTGTCTCATTGATTGGAGGTGAGTTTC
GTTGACGTGCCATCCGAACAGAATTCGTGTTCATCATCATTTTCCTTAGCTTCTTCGAGCACACATGGGAACCAG
ATGGGTGCTCGTACTATTTTCCCGGCCGTTTCTTGTAGTGGTACGACTTGCACGATCACTGCACCTCCTAATGCT
GGTATCTGTCCTCCCGGTTGGTTCATGCTCTTCGTGCTGGATGGTTCCACACCTTCTGTTGCTCGTTGGGTTCGT
ATTGGTGGTGACCCGTCCCAAATGGGAAATTGGCCGGATATGCCTGGCTTTACGCTCCCGGGTCTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail