Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|023220
Gene name
Locationscaffold_11:461072..462607
Strand-
Gene length (bp)1535
Transcript length (bp)1425
Coding sequence length (bp)1425
Protein length (aa) 475

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 9.1E-20 33 430

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74902|YCS2_SCHPO Uncharacterized MFS-type transporter C613.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC613.02 PE=3 SV=1 6 474 1.0E-68
sp|O74901|YCS1_SCHPO Uncharacterized protein CC613.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC613.01 PE=1 SV=1 15 474 4.0E-68
sp|Q12519|YJ87_SCHPO Uncharacterized MFS-type transporter C330.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC330.07c PE=1 SV=1 16 472 1.0E-64
sp|O74921|YJ7B_SCHPO Uncharacterized MFS-type transporter C757.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.11c PE=3 SV=1 15 472 6.0E-55
sp|Q9T050|SPXM2_ARATH SPX domain-containing membrane protein At4g11810 OS=Arabidopsis thaliana GN=At4g11810 PE=3 SV=1 6 227 3.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74902|YCS2_SCHPO Uncharacterized MFS-type transporter C613.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC613.02 PE=3 SV=1 6 474 1.0E-68
sp|O74901|YCS1_SCHPO Uncharacterized protein CC613.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC613.01 PE=1 SV=1 15 474 4.0E-68
sp|Q12519|YJ87_SCHPO Uncharacterized MFS-type transporter C330.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC330.07c PE=1 SV=1 16 472 1.0E-64
sp|O74921|YJ7B_SCHPO Uncharacterized MFS-type transporter C757.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.11c PE=3 SV=1 15 472 6.0E-55
sp|Q9T050|SPXM2_ARATH SPX domain-containing membrane protein At4g11810 OS=Arabidopsis thaliana GN=At4g11810 PE=3 SV=1 6 227 3.0E-18
sp|Q0JAW2|SPXM2_ORYSJ SPX domain-containing membrane protein Os04g0573000 OS=Oryza sativa subsp. japonica GN=Os04g0573000 PE=2 SV=2 28 356 2.0E-17
sp|B8AT51|SPXM2_ORYSI SPX domain-containing membrane protein OsI_17046 OS=Oryza sativa subsp. indica GN=OsI_17046 PE=3 SV=1 28 356 2.0E-17
sp|Q6EPQ3|SPXM1_ORYSJ SPX domain-containing membrane protein Os02g45520 OS=Oryza sativa subsp. japonica GN=Os02g0678200 PE=2 SV=1 38 356 5.0E-17
sp|A2X8A7|SPXM1_ORYSI SPX domain-containing membrane protein OsI_08463 OS=Oryza sativa subsp. indica GN=OsI_08463 PE=3 SV=2 38 356 5.0E-17
sp|Q2V4F9|SPXM1_ARATH SPX domain-containing membrane protein At1g63010 OS=Arabidopsis thaliana GN=At1g63010 PE=2 SV=1 8 207 5.0E-17
sp|Q658H5|SPXM3_ORYSJ SPX domain-containing membrane protein Os06g0129400 OS=Oryza sativa subsp. japonica GN=Os06g0129400 PE=2 SV=1 12 206 2.0E-16
sp|A2Y8U6|SPXM3_ORYSI SPX domain-containing membrane protein OsI_21475 OS=Oryza sativa subsp. indica GN=OsI_21475 PE=3 SV=1 12 206 2.0E-16
sp|Q93ZQ5|SPXM3_ARATH SPX domain-containing membrane protein At4g22990 OS=Arabidopsis thaliana GN=At4g22990 PE=2 SV=2 28 356 7.0E-16
sp|B8BDK8|SPXM4_ORYSI SPX domain-containing membrane protein OsI_32082 OS=Oryza sativa subsp. indica GN=OsI_32082 PE=3 SV=2 12 206 9.0E-09
sp|B9FMX4|SPXM4_ORYSJ SPX domain-containing membrane protein Os09g0521800 OS=Oryza sativa subsp. japonica GN=Os09g0521800 PE=3 SV=2 12 206 3.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.5

Transmembrane Domains

Domain # Start End Length
1 29 48 19
2 63 85 22
3 92 109 17
4 114 136 22
5 156 178 22
6 191 213 22
7 283 303 20
8 323 345 22
9 352 374 22
10 384 406 22
11 415 437 22
12 447 469 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|023220
MQPPADDDDRLSATSIDPEELRIPKKSSLSIIVICNCLLQVSFFIIVSSSNDYANRLGGDSTFSGIVIGIPTAIS
ALALIPIIRYDKGGYTLPLNISCASMILGHILYACAYQTSWLYLILIGRIINGFGFTMWMYCKRYCSDARIVGIR
RRTTLASFLVVGQGLGMSLGPFAGGLLYKVGFRNTVFNGFTSPSWVMAAVWCCFWVCTRLFFVDVPKDARYTSQP
PSQPLTESTPTTNTPSPDDDKEKTSDPTTKDTIPTYPPPPPPTTNTPTPKYKMSLTQIGVLSCMCWFAMTCFFIL
GAWEANLPVFGSSTPQFHWSPTASGNFIALGGISCFPFLILNIFLTRRISDRLTLLFGASLGLSASLVFLSLLRT
SKLNYGSIFICWWGVALGFNIASTTPVSLLSKQLPPEWNGWVSLAIQYSMYTGRVTGAIWGGSGVKVGMMNYIGL
QIGLVGLGLVMLMILWDGLKAKRG*
Coding >AgabiH97|023220
ATGCAACCACCAGCAGACGACGATGATAGACTCAGTGCCACCTCGATAGACCCAGAGGAACTCCGGATTCCTAAG
AAATCATCCCTCAGCATCATAGTCATCTGCAACTGTCTTCTTCAAGTTTCTTTCTTCATCATTGTCTCGTCGTCC
AATGACTATGCAAACCGCCTCGGTGGAGACTCGACCTTTTCTGGTATCGTCATCGGTATTCCAACTGCAATCTCA
GCACTCGCATTGATTCCCATCATACGATATGACAAAGGTGGTTATACCCTACCTCTCAACATCAGCTGCGCATCT
ATGATCCTCGGACATATCCTCTACGCCTGCGCCTACCAAACCTCTTGGCTCTACCTCATCCTCATCGGTCGCATC
ATCAACGGTTTCGGTTTCACTATGTGGATGTACTGCAAACGCTATTGTTCCGACGCCCGTATAGTCGGTATCCGT
CGCAGAACCACTCTCGCGAGTTTCCTTGTCGTAGGTCAAGGACTCGGTATGAGTCTAGGTCCCTTTGCCGGAGGT
TTGTTGTATAAGGTTGGGTTTAGGAATACTGTTTTTAATGGATTTACGAGTCCGAGTTGGGTTATGGCTGCGGTA
TGGTGTTGTTTTTGGGTGTGCACCCGATTGTTTTTCGTCGACGTACCCAAAGACGCTAGATACACCTCCCAACCA
CCATCCCAACCACTCACCGAATCCACTCCAACCACCAACACTCCTTCACCCGACGACGACAAAGAAAAAACCTCC
GACCCAACCACCAAAGACACCATCCCCACCTATCCTCCCCCTCCCCCTCCCACCACCAACACCCCCACCCCCAAA
TACAAAATGTCCCTAACCCAAATCGGCGTCCTATCCTGCATGTGCTGGTTCGCCATGACCTGTTTCTTCATCCTC
GGCGCCTGGGAAGCCAACCTCCCCGTCTTCGGTTCCTCCACCCCCCAATTCCACTGGTCCCCAACCGCCTCAGGT
AATTTCATAGCCCTAGGCGGTATATCCTGTTTCCCCTTCCTCATCCTCAACATCTTCCTCACCCGTCGAATCTCC
GACCGTCTCACCCTCCTATTCGGTGCCTCTCTCGGTCTCTCAGCCTCACTCGTCTTCCTCTCTCTCCTTCGTACT
TCCAAACTCAATTACGGTAGCATCTTTATATGTTGGTGGGGTGTAGCTTTGGGTTTTAACATCGCTAGTACCACA
CCTGTGAGTCTATTAAGTAAACAATTACCACCAGAATGGAATGGGTGGGTATCTTTGGCGATTCAGTATAGCATG
TACACGGGTCGTGTGACGGGTGCCATTTGGGGTGGGAGTGGTGTCAAAGTCGGGATGATGAATTATATTGGGTTG
CAGATTGGGTTGGTTGGACTTGGATTGGTTATGTTGATGATATTGTGGGATGGGTTGAAAGCGAAACGAGGGTAG
Transcript >AgabiH97|023220
ATGCAACCACCAGCAGACGACGATGATAGACTCAGTGCCACCTCGATAGACCCAGAGGAACTCCGGATTCCTAAG
AAATCATCCCTCAGCATCATAGTCATCTGCAACTGTCTTCTTCAAGTTTCTTTCTTCATCATTGTCTCGTCGTCC
AATGACTATGCAAACCGCCTCGGTGGAGACTCGACCTTTTCTGGTATCGTCATCGGTATTCCAACTGCAATCTCA
GCACTCGCATTGATTCCCATCATACGATATGACAAAGGTGGTTATACCCTACCTCTCAACATCAGCTGCGCATCT
ATGATCCTCGGACATATCCTCTACGCCTGCGCCTACCAAACCTCTTGGCTCTACCTCATCCTCATCGGTCGCATC
ATCAACGGTTTCGGTTTCACTATGTGGATGTACTGCAAACGCTATTGTTCCGACGCCCGTATAGTCGGTATCCGT
CGCAGAACCACTCTCGCGAGTTTCCTTGTCGTAGGTCAAGGACTCGGTATGAGTCTAGGTCCCTTTGCCGGAGGT
TTGTTGTATAAGGTTGGGTTTAGGAATACTGTTTTTAATGGATTTACGAGTCCGAGTTGGGTTATGGCTGCGGTA
TGGTGTTGTTTTTGGGTGTGCACCCGATTGTTTTTCGTCGACGTACCCAAAGACGCTAGATACACCTCCCAACCA
CCATCCCAACCACTCACCGAATCCACTCCAACCACCAACACTCCTTCACCCGACGACGACAAAGAAAAAACCTCC
GACCCAACCACCAAAGACACCATCCCCACCTATCCTCCCCCTCCCCCTCCCACCACCAACACCCCCACCCCCAAA
TACAAAATGTCCCTAACCCAAATCGGCGTCCTATCCTGCATGTGCTGGTTCGCCATGACCTGTTTCTTCATCCTC
GGCGCCTGGGAAGCCAACCTCCCCGTCTTCGGTTCCTCCACCCCCCAATTCCACTGGTCCCCAACCGCCTCAGGT
AATTTCATAGCCCTAGGCGGTATATCCTGTTTCCCCTTCCTCATCCTCAACATCTTCCTCACCCGTCGAATCTCC
GACCGTCTCACCCTCCTATTCGGTGCCTCTCTCGGTCTCTCAGCCTCACTCGTCTTCCTCTCTCTCCTTCGTACT
TCCAAACTCAATTACGGTAGCATCTTTATATGTTGGTGGGGTGTAGCTTTGGGTTTTAACATCGCTAGTACCACA
CCTGTGAGTCTATTAAGTAAACAATTACCACCAGAATGGAATGGGTGGGTATCTTTGGCGATTCAGTATAGCATG
TACACGGGTCGTGTGACGGGTGCCATTTGGGGTGGGAGTGGTGTCAAAGTCGGGATGATGAATTATATTGGGTTG
CAGATTGGGTTGGTTGGACTTGGATTGGTTATGTTGATGATATTGTGGGATGGGTTGAAAGCGAAACGAGGGTAG
Gene >AgabiH97|023220
ATGCAACCACCAGCAGACGACGATGATAGACTCAGTGCCACCTCGATAGACCCAGAGGAACTCCGGATTCCTAAG
AAATCATCCCTCAGCATCATAGTCATCTGCAACTGTCTTCTTCAAGTTGGCTTTTCCCAAAAATAGCAAATCCAA
TATCTGACATCGATCTTTTTCTATTTAGGTTTCTTTCTTCATCATTGTCTCGTCGTCCAATGACTATGCAAACCG
CCTCGGTGGAGACTCGACCTTTTCTGGTATCGTCATCGGTATTCCAACTGCAATCTCAGCACTCGCATTGATTCC
CATCATACGATATGACAAAGGTAAAATAAAAATATCGCTTCTCCAAGTACTAGTATAACTCAATACTCGCAGGTG
GTTATACCCTACCTCTCAACATCAGCTGCGCATCTATGATCCTCGGACATATCCTCTACGCCTGCGCCTACCAAA
CCTCTTGGCTCTACCTCATCCTCATCGGTCGCATCATCAACGGTTTCGGTTTCACTATGTGGATGTACTGCAAAC
GCTATTGTTCCGACGCCCGTATAGTCGGTATCCGTCGCAGAACCACTCTCGCGAGTTTCCTTGTCGTAGGTCAAG
GACTCGGTATGAGTCTAGGTCCCTTTGCCGGAGGTTTGTTGTATAAGGTTGGGTTTAGGAATACTGTTTTTAATG
GATTTACGAGTCCGAGTTGGGTTATGGCTGCGGTATGGTGTTGTTTTTGGGTGTGCACCCGATTGTTTTTCGTCG
ACGTACCCAAAGACGCTAGATACACCTCCCAACCACCATCCCAACCACTCACCGAATCCACTCCAACCACCAACA
CTCCTTCACCCGACGACGACAAAGAAAAAACCTCCGACCCAACCACCAAAGACACCATCCCCACCTATCCTCCCC
CTCCCCCTCCCACCACCAACACCCCCACCCCCAAATACAAAATGTCCCTAACCCAAATCGGCGTCCTATCCTGCA
TGTGCTGGTTCGCCATGACCTGTTTCTTCATCCTCGGCGCCTGGGAAGCCAACCTCCCCGTCTTCGGTTCCTCCA
CCCCCCAATTCCACTGGTCCCCAACCGCCTCAGGTAATTTCATAGCCCTAGGCGGTATATCCTGTTTCCCCTTCC
TCATCCTCAACATCTTCCTCACCCGTCGAATCTCCGACCGTCTCACCCTCCTATTCGGTGCCTCTCTCGGTCTCT
CAGCCTCACTCGTCTTCCTCTCTCTCCTTCGTACTTCCAAACTCAATTACGGTAGCATCTTTATATGTTGGTGGG
GTGTAGCTTTGGGTTTTAACATCGCTAGTACCACACCTGTGAGTCTATTAAGTAAACAATTACCACCAGAATGGA
ATGGGTGGGTATCTTTGGCGATTCAGTATAGCATGTACACGGGTCGTGTGACGGGTGCCATTTGGGGTGGGAGTG
GTGTCAAAGTCGGGATGATGAATTATATTGGGTTGCAGATTGGGTTGGTTGGACTTGGATTGGTTATGTTGATGA
TATTGTGGGATGGGTTGAAAGCGAAACGAGGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail