Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|023010
Gene name
Locationscaffold_11:392961..394834
Strand-
Gene length (bp)1873
Transcript length (bp)1527
Coding sequence length (bp)1527
Protein length (aa) 509

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01417 ENTH ENTH domain 8.5E-49 19 142

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74423|ENT1_SCHPO Epsin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ent1 PE=1 SV=1 11 367 2.0E-65
sp|Q9H201|EPN3_HUMAN Epsin-3 OS=Homo sapiens GN=EPN3 PE=2 SV=1 10 235 6.0E-50
sp|Q8CHU3|EPN2_MOUSE Epsin-2 OS=Mus musculus GN=Epn2 PE=1 SV=1 10 241 7.0E-50
sp|Q9Z1Z3|EPN2_RAT Epsin-2 OS=Rattus norvegicus GN=Epn2 PE=1 SV=1 10 236 8.0E-50
sp|Q4V882|EPN3_RAT Epsin-3 OS=Rattus norvegicus GN=Epn3 PE=1 SV=1 10 165 1.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74423|ENT1_SCHPO Epsin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ent1 PE=1 SV=1 11 367 2.0E-65
sp|Q9H201|EPN3_HUMAN Epsin-3 OS=Homo sapiens GN=EPN3 PE=2 SV=1 10 235 6.0E-50
sp|Q8CHU3|EPN2_MOUSE Epsin-2 OS=Mus musculus GN=Epn2 PE=1 SV=1 10 241 7.0E-50
sp|Q9Z1Z3|EPN2_RAT Epsin-2 OS=Rattus norvegicus GN=Epn2 PE=1 SV=1 10 236 8.0E-50
sp|Q4V882|EPN3_RAT Epsin-3 OS=Rattus norvegicus GN=Epn3 PE=1 SV=1 10 165 1.0E-49
sp|Q91W69|EPN3_MOUSE Epsin-3 OS=Mus musculus GN=Epn3 PE=1 SV=1 10 165 2.0E-49
sp|O95208|EPN2_HUMAN Epsin-2 OS=Homo sapiens GN=EPN2 PE=1 SV=3 10 156 3.0E-49
sp|Q80VP1|EPN1_MOUSE Epsin-1 OS=Mus musculus GN=Epn1 PE=1 SV=3 10 156 6.0E-48
sp|Q9Y6I3|EPN1_HUMAN Epsin-1 OS=Homo sapiens GN=EPN1 PE=1 SV=2 10 156 8.0E-48
sp|O88339|EPN1_RAT Epsin-1 OS=Rattus norvegicus GN=Epn1 PE=1 SV=1 10 156 8.0E-48
sp|Q05785|ENT2_YEAST Epsin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENT2 PE=1 SV=1 4 229 4.0E-44
sp|Q8IYW4|ENTD1_HUMAN ENTH domain-containing protein 1 OS=Homo sapiens GN=ENTHD1 PE=2 SV=1 10 155 3.0E-42
sp|Q67YI9|EPN2_ARATH Clathrin interactor EPSIN 2 OS=Arabidopsis thaliana GN=EPSIN2 PE=1 SV=1 25 169 1.0E-35
sp|Q99KN9|EPN4_MOUSE Clathrin interactor 1 OS=Mus musculus GN=Clint1 PE=1 SV=2 11 146 6.0E-35
sp|A7Z035|EPN4_BOVIN Clathrin interactor 1 OS=Bos taurus GN=CLINT1 PE=2 SV=1 14 146 8.0E-35
sp|Q14677|EPN4_HUMAN Clathrin interactor 1 OS=Homo sapiens GN=CLINT1 PE=1 SV=1 14 146 9.0E-35
sp|Q93YP4|EPN3_ARATH Clathrin interactor EPSIN 3 OS=Arabidopsis thaliana GN=EPSIN3 PE=2 SV=1 25 180 8.0E-34
sp|Q54EH1|EPN_DICDI Epsin OS=Dictyostelium discoideum GN=epnA PE=3 SV=1 1 163 2.0E-32
sp|P47160|ENT3_YEAST Epsin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENT3 PE=1 SV=1 5 168 2.0E-30
sp|P78813|YCTB_SCHPO ENTH domain-containing protein C794.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.11c PE=1 SV=2 6 163 5.0E-30
sp|Q8VY07|EPN1_ARATH Clathrin interactor EPSIN 1 OS=Arabidopsis thaliana GN=EPSIN1 PE=1 SV=1 25 157 8.0E-27
sp|Q07872|ENT4_YEAST Epsin-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENT4 PE=1 SV=1 20 135 3.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|023010
MQHFGKAALRITKNYTKGYSDTQAKVRDATSNDPWGPSGTQMNEIAQLTYNQNDFIEIMEMLDKRLNDKGKNWRH
VFKSLTVLDYCLHQGSENVVIYFRDNIYIVKTLKEFQFIDDDGKDQGANVRQKAKDISNLLVDEARLREERRARA
SMRDRMIRGTGGDYGAGDELGVPGDENKSRRQPNGGGPPRRKNVDEDDLKRAIEESKKTLAQEQRDAEERELEKA
IQLSKDEEEKRKHAVEDSNAAALFDDQNQLPSPSSHSNNPFPLLDPTPYAVGLQPQYTVQQQYTSVQPQFTSFNP
YQQQMEQEAAQAEYLRQQQAFQQQQQAQQQQQQQEEWMRQQQMLQMQQQQQQNLFAQQQLAPQPTGFGSNNPFAP
TTSLGSTPAQSPVTQNPPSFNLSGTYDSHSPANLSTLSSPEPSRSPQPYNGGPAKPINVRTKKELGENEAHLADL
FANRDDGQDTFGNIGALRFGQTEAGRVLAQRTGATSAASSHNPFAKQPQSTDQPFFNI*
Coding >AgabiH97|023010
ATGCAGCATTTTGGCAAGGCGGCGCTCAGGATCACGAAAAACTACACCAAAGGCTACTCGGACACGCAGGCAAAG
GTCCGCGATGCCACCTCAAACGACCCCTGGGGTCCCTCAGGAACACAGATGAACGAGATTGCGCAGTTGACTTAC
AATCAGAATGACTTTATTGAGATCATGGAGATGCTAGACAAGCGTCTCAACGACAAAGGCAAGAACTGGCGGCAT
GTCTTCAAGAGTCTCACGGTCTTAGACTATTGCCTTCACCAAGGCTCCGAGAACGTCGTCATCTACTTCCGCGAC
AACATTTACATCGTCAAGACACTCAAAGAATTCCAGTTTATAGACGACGATGGCAAAGACCAGGGTGCAAATGTT
CGACAAAAGGCCAAGGACATCAGCAACCTACTCGTAGATGAGGCCCGTCTCCGTGAGGAACGAAGAGCCCGAGCA
TCCATGCGTGATCGTATGATCCGCGGTACTGGCGGAGATTATGGTGCAGGAGATGAACTTGGTGTGCCAGGTGAC
GAGAACAAAAGTCGAAGGCAACCGAACGGTGGCGGTCCTCCGAGAAGAAAGAACGTGGACGAAGACGATTTGAAA
CGTGCCATTGAGGAGAGTAAAAAGACGTTGGCACAAGAACAACGCGATGCCGAGGAGCGAGAGCTCGAAAAGGCC
ATTCAACTCAGTAAGGACGAGGAAGAGAAGAGAAAGCACGCCGTCGAGGACTCGAATGCCGCGGCTCTGTTCGAT
GATCAAAACCAGCTCCCCAGTCCTAGCAGCCATAGCAACAACCCTTTCCCTCTACTCGACCCGACGCCTTACGCA
GTTGGACTTCAGCCTCAATATACGGTTCAACAACAGTATACTTCAGTTCAACCTCAATTCACCTCCTTCAATCCT
TATCAACAACAGATGGAGCAGGAGGCGGCGCAGGCCGAGTATCTGCGCCAACAACAAGCCTTTCAACAACAACAA
CAAGCGCAGCAGCAGCAACAGCAACAGGAAGAATGGATGCGTCAACAGCAGATGCTCCAAATGCAGCAACAACAA
CAACAGAACCTATTCGCGCAGCAACAGCTTGCGCCTCAACCAACAGGATTTGGATCCAACAATCCCTTTGCGCCA
ACAACCTCTCTCGGCTCAACTCCGGCTCAATCTCCAGTCACCCAAAATCCACCATCATTCAATCTTAGCGGAACA
TACGATTCTCATTCTCCAGCAAATCTGTCTACACTTTCTAGCCCTGAACCTTCCCGCAGTCCTCAGCCTTACAAT
GGAGGACCTGCTAAACCCATCAACGTCAGGACGAAGAAGGAGCTGGGAGAGAATGAAGCACATTTGGCAGACCTA
TTTGCGAATAGGGATGACGGTCAGGATACATTTGGAAATATTGGCGCTTTGCGGTTTGGTCAAACAGAAGCTGGA
CGAGTTTTGGCGCAGCGAACTGGAGCTACCAGTGCGGCCAGTTCGCATAATCCGTTTGCGAAGCAGCCTCAAAGC
ACTGACCAGCCATTCTTCAATATCTAA
Transcript >AgabiH97|023010
ATGCAGCATTTTGGCAAGGCGGCGCTCAGGATCACGAAAAACTACACCAAAGGCTACTCGGACACGCAGGCAAAG
GTCCGCGATGCCACCTCAAACGACCCCTGGGGTCCCTCAGGAACACAGATGAACGAGATTGCGCAGTTGACTTAC
AATCAGAATGACTTTATTGAGATCATGGAGATGCTAGACAAGCGTCTCAACGACAAAGGCAAGAACTGGCGGCAT
GTCTTCAAGAGTCTCACGGTCTTAGACTATTGCCTTCACCAAGGCTCCGAGAACGTCGTCATCTACTTCCGCGAC
AACATTTACATCGTCAAGACACTCAAAGAATTCCAGTTTATAGACGACGATGGCAAAGACCAGGGTGCAAATGTT
CGACAAAAGGCCAAGGACATCAGCAACCTACTCGTAGATGAGGCCCGTCTCCGTGAGGAACGAAGAGCCCGAGCA
TCCATGCGTGATCGTATGATCCGCGGTACTGGCGGAGATTATGGTGCAGGAGATGAACTTGGTGTGCCAGGTGAC
GAGAACAAAAGTCGAAGGCAACCGAACGGTGGCGGTCCTCCGAGAAGAAAGAACGTGGACGAAGACGATTTGAAA
CGTGCCATTGAGGAGAGTAAAAAGACGTTGGCACAAGAACAACGCGATGCCGAGGAGCGAGAGCTCGAAAAGGCC
ATTCAACTCAGTAAGGACGAGGAAGAGAAGAGAAAGCACGCCGTCGAGGACTCGAATGCCGCGGCTCTGTTCGAT
GATCAAAACCAGCTCCCCAGTCCTAGCAGCCATAGCAACAACCCTTTCCCTCTACTCGACCCGACGCCTTACGCA
GTTGGACTTCAGCCTCAATATACGGTTCAACAACAGTATACTTCAGTTCAACCTCAATTCACCTCCTTCAATCCT
TATCAACAACAGATGGAGCAGGAGGCGGCGCAGGCCGAGTATCTGCGCCAACAACAAGCCTTTCAACAACAACAA
CAAGCGCAGCAGCAGCAACAGCAACAGGAAGAATGGATGCGTCAACAGCAGATGCTCCAAATGCAGCAACAACAA
CAACAGAACCTATTCGCGCAGCAACAGCTTGCGCCTCAACCAACAGGATTTGGATCCAACAATCCCTTTGCGCCA
ACAACCTCTCTCGGCTCAACTCCGGCTCAATCTCCAGTCACCCAAAATCCACCATCATTCAATCTTAGCGGAACA
TACGATTCTCATTCTCCAGCAAATCTGTCTACACTTTCTAGCCCTGAACCTTCCCGCAGTCCTCAGCCTTACAAT
GGAGGACCTGCTAAACCCATCAACGTCAGGACGAAGAAGGAGCTGGGAGAGAATGAAGCACATTTGGCAGACCTA
TTTGCGAATAGGGATGACGGTCAGGATACATTTGGAAATATTGGCGCTTTGCGGTTTGGTCAAACAGAAGCTGGA
CGAGTTTTGGCGCAGCGAACTGGAGCTACCAGTGCGGCCAGTTCGCATAATCCGTTTGCGAAGCAGCCTCAAAGC
ACTGACCAGCCATTCTTCAATATCTAA
Gene >AgabiH97|023010
ATGCAGCATTTTGGCAAGGCGGCGCTCAGGATCACGAAAAACTACACCAAAGGCTACTCGGACACGCAGGCAAAG
GTCCGCGATGCCACCTCAAACGACCCCTGGGGTCCCTCAGGAACACAGATGAACGAGATTGCGCAGTTGACTTAC
AATCAGTCCGTCTGCTTGTTCACTTCCTGCCTTCGTCCTGCTCATCTTCTTCTGCCCCTCCAGGAATGACTTTAT
TGAGATCATGGAGATGCTAGACAAGCGTCTCAACGACAAAGGCAAGAACTGGCGGCATGTCTTCAAGGTGAGCCC
GGAGTCACTCGCAACGCCCGCCGCAGTACTTAGACTCCGGTCTGTAGAGTCTCACGGTCTTAGACTATTGCCTTC
ACCAAGGCTCCGAGAACGTCGTCATCTACTTCCGCGACAACATTTACATCGTCAAGACACTCAAAGAATTCCAGT
TTATAGACGACGATGGCAAAGACCAGGGTGCAAATGTTCGACAAAAGGCCAAGGACATCAGCAACCTACTCGTAG
ATGAGGCCCGTCTCCGTGAGGAACGAAGAGCCCGAGCATCCATGCGTGATCGTATGATCCGCGGTACTGGCGGAG
ATTATGGTGCAGGAGATGAACTTGGTGTGCCAGGTGACGAGAACAAAAGTCGAAGGCAACCGAACGGTGGCGGTC
CTCCGAGAAGAAAGAACGTGGACGAAGACGATTTGAAACGTGCCATTGAGGAGAGTAAAAAGACGTTGGCACAAG
AACAACGCGATGCCGAGGAGCGAGAGCTCGAAAAGGCCATTCAACTCAGTAAGGACGAGGAAGAGAAGAGAAAGC
ACGCCGTCGAGGACTCGAATGCCGCGGCTCTGTTCGATGATCAAAACCAGCTGTGAGTGTTCCTTTGACCGATAA
GAATAGTGTCTTTGACGTATTGCATCGTAACGTGTAGCCCCAGTCCTAGCAGCCATAGCAACAACCCTTTCCCTC
TACTCGACCCGACGCCTTACGCAGTTGGACTTCAGCCTCAATATACGGTTCAACAACAGTATACTTCAGTTCAAC
CTCAATTCACCTCCTTCAATCCTTATCAACAACAGATGGAGCAGGAGGCGGCGCAGGTGAGACCGATATATTTCG
CTGTCGTCTTTCTCAATTCAGTGTACTTCAACTCGCTAGGCCGAGTATCTGCGCCAACAACAAGCCTTTCAACAA
CAACAACAAGCGCAGCAGCAGCAACAGCAACAGGAAGAATGGATGCGTCAACAGCAGATGCTCCAAATGCAGCAA
CAACAACAACAGAACCTATTCGCGCAGCAACAGCTTGCGCCTCAACCAACAGGATTTGGGTACGCCAGCCCCGTG
CTTTCGAACTTGCCGGCAATGGTGATTAAATATCTAATAGATCCAACAATCCCTTTGCGCCAACAACCTCTCTCG
GCTCAACTCCGGCTCAATCTCCAGTCACCCAAAATCCACCATCATTCAATCTTAGCGGAACATACGATTCTCATT
CTCCAGCAAATCTGTCTACACTTTCTAGCCCTGAACCTTCCCGCAGTCCTCAGCCTTACAATGGAGGACCTGCTA
AACCCATCAACGTCAGGACGAAGAAGGAGCTGGGAGAGAATGAAGCACATTTGGCAGACCTATTTGCGAATAGGG
ATGACGGTCAGGATACATTTGGAAATATTGGCGCTTTGCGGTATGTGCTTCATTTTGCGCGATATTAGTGAAATA
TTAATGCGTATCGTATCTGTTTAGGTTTGGTCAAACAGAAGCTGGACGAGTTTTGGCGCAGCGAACTGGAGCTAC
CAGTGCGGCCAGTTCGCATAATCCGTTTGCGAAGCAGCCTCAAAGCACTGACCAGCCATTCTTCAATATCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail