Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|022700
Gene name
Locationscaffold_11:326731..328034
Strand+
Gene length (bp)1303
Transcript length (bp)933
Coding sequence length (bp)933
Protein length (aa) 311

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AK17|PLCX1_ARTBC PI-PLC X domain-containing protein 1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04618 PE=1 SV=1 24 309 7.0E-64
sp|D4AUX6|A8043_ARTBC Uncharacterized secreted protein ARB_08043 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_08043 PE=1 SV=1 22 309 9.0E-57
sp|Q93XX5|Y5713_ARATH PI-PLC X domain-containing protein At5g67130 OS=Arabidopsis thaliana GN=At5g67130 PE=1 SV=1 42 308 2.0E-11

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|022700
MGNIFHWSLVFAALVHCSLGLQPPQRRATVCNGHAELCDRAYSNVTTIGSHDSFAFSSNPLILARDQQVDIPTQL
NLGVRLLQAQSHVNDGVIHFCHTSCILFDGGTVVDYLKLVKTFLDSHPNEVLTFIFTNPENLSLTDVWKPAFDEA
GITPLAYVPPHVPMKNSEWPTLGEMIDSGKRVVVFLDAGADTSQVDFLLPEFEMIWETPFGVTDPSFPCSVDRID
GPLSTADHSYMINHSLNKNILPIGDGVLVSDPLDAPTTNSVNSIIANVEGCVPLSGANRKPQFVLLDYVDIGNAF
QAANQLNGLA*
Coding >AgabiH97|022700
ATGGGGAACATCTTTCACTGGTCTTTGGTATTTGCAGCTTTGGTCCACTGCAGTCTTGGGTTACAGCCGCCCCAG
CGGAGGGCTACCGTTTGTAATGGCCATGCCGAACTGTGCGATCGAGCCTACTCAAATGTGACGACTATAGGATCC
CACGACTCGTTTGCGTTCAGCTCGAATCCCCTGATTCTTGCTAGGGATCAACAAGTTGATATACCGACCCAACTG
AATCTTGGTGTTCGACTATTGCAAGCTCAGTCACATGTGAACGATGGAGTTATTCATTTCTGCCATACGAGCTGT
ATCTTGTTTGATGGAGGAACAGTCGTCGATTACCTCAAGCTTGTCAAAACATTCTTGGACAGTCACCCTAACGAA
GTGCTCACCTTTATCTTCACGAATCCGGAGAACTTATCGCTCACTGATGTTTGGAAACCTGCCTTTGATGAAGCC
GGTATTACGCCTCTGGCTTATGTACCACCACATGTACCCATGAAGAACTCGGAATGGCCGACACTTGGAGAAATG
ATTGACAGCGGAAAGAGAGTTGTTGTCTTCCTTGACGCTGGAGCTGATACTTCCCAAGTCGATTTTCTCTTACCA
GAATTCGAGATGATCTGGGAAACGCCTTTTGGGGTTACAGATCCAAGCTTCCCGTGCAGCGTAGACCGTATTGAT
GGTCCATTGTCGACTGCCGATCATTCTTATATGATCAATCATTCTCTGAACAAGAACATTCTTCCCATCGGGGAC
GGTGTCCTTGTCAGTGATCCCCTTGATGCACCGACAACTAACAGTGTTAATTCGATTATTGCGAATGTCGAAGGT
TGTGTTCCGCTTAGTGGAGCTAACCGCAAACCACAGTTCGTTCTTCTTGACTATGTGGATATTGGAAATGCTTTT
CAAGCGGCCAATCAATTAAATGGTTTAGCGTAA
Transcript >AgabiH97|022700
ATGGGGAACATCTTTCACTGGTCTTTGGTATTTGCAGCTTTGGTCCACTGCAGTCTTGGGTTACAGCCGCCCCAG
CGGAGGGCTACCGTTTGTAATGGCCATGCCGAACTGTGCGATCGAGCCTACTCAAATGTGACGACTATAGGATCC
CACGACTCGTTTGCGTTCAGCTCGAATCCCCTGATTCTTGCTAGGGATCAACAAGTTGATATACCGACCCAACTG
AATCTTGGTGTTCGACTATTGCAAGCTCAGTCACATGTGAACGATGGAGTTATTCATTTCTGCCATACGAGCTGT
ATCTTGTTTGATGGAGGAACAGTCGTCGATTACCTCAAGCTTGTCAAAACATTCTTGGACAGTCACCCTAACGAA
GTGCTCACCTTTATCTTCACGAATCCGGAGAACTTATCGCTCACTGATGTTTGGAAACCTGCCTTTGATGAAGCC
GGTATTACGCCTCTGGCTTATGTACCACCACATGTACCCATGAAGAACTCGGAATGGCCGACACTTGGAGAAATG
ATTGACAGCGGAAAGAGAGTTGTTGTCTTCCTTGACGCTGGAGCTGATACTTCCCAAGTCGATTTTCTCTTACCA
GAATTCGAGATGATCTGGGAAACGCCTTTTGGGGTTACAGATCCAAGCTTCCCGTGCAGCGTAGACCGTATTGAT
GGTCCATTGTCGACTGCCGATCATTCTTATATGATCAATCATTCTCTGAACAAGAACATTCTTCCCATCGGGGAC
GGTGTCCTTGTCAGTGATCCCCTTGATGCACCGACAACTAACAGTGTTAATTCGATTATTGCGAATGTCGAAGGT
TGTGTTCCGCTTAGTGGAGCTAACCGCAAACCACAGTTCGTTCTTCTTGACTATGTGGATATTGGAAATGCTTTT
CAAGCGGCCAATCAATTAAATGGTTTAGCGTAA
Gene >AgabiH97|022700
ATGGGGAACATCTTTCACTGGTCTTTGGTATTTGCAGCTTTGGTCCACTGCAGTCTTGGGTTACAGCCGCCCCAG
CGGAGGTGAGTCCTAGTTTTTGTAACGGAGAGACACGCTGATTCCAGATTTTGAAAGGGCTACCGTTTGTAATGG
CCATGCCGAACTGTGCGATCGAGCCTACTCAAATGTGACGACTATAGGATCCCACGACTCGTTTGCGTTCAGCTC
GAATCCCCTGATTCGTAACTATCTTCAATAATAGGTTTAACGCGCCATTCAATCATAAATTAGTTGCTAGGGATC
AACAAGTTGATATACCGACCCAACTGAATCTTGGTGTTCGACTATTGCAAGCTCAGTCACATGTGTAAGTTAGCT
AGTTTTTTCCGTTCTTGGACAAGTCATCATGTGGTGGAACTACAGGAACGATGGAGTTATTCATTTCTGCCATAC
GAGCTGTGTAAGCTTGAAGCAAGTTTTTATCAAAGACACGCAACTGATATTGACGCCTAGATCTTGTTTGATGGA
GGAACAGTCGTCGATTACCTCAAGCTTGTCAAAACATTCTTGGACAGTCACCCTAACGAAGTGCTCACCTTTATC
TTCACGAATCCGGAGAACTTATCGCTCACTGATGTTTGGAAACCTGCCTTTGATGAAGCCGGTATGTGAAGGCAC
AGATGAGGCCGTAAAATCGCACTGACTAGTCTCCAAGGTATTACGCCTCTGGCTTATGTACCACCACATGTACCC
ATGAAGAACTCGGAATGGCCGACACTTGGAGAAATGATTGACAGCGGAAAGAGAGTTGTTGTCTTCCTTGACGCT
GGAGCTGATACTTCCCAAGTCGATTTTCTCTTACCAGAATTCGAGATGGTGAGCCTTCATTTATCCAACTTCGTT
ATAAATTTTGTGAATGATTTCTCTCGAAATAGATCTGGGAAACGCCTTTTGGGGTTACAGATCCAAGCTTCCCGT
GCAGCGTAGACCGTATTGATGGTCCATTGTCGACTGCCGATCATTCTTATATGATCAATCATTCTCTGAACAAGA
ACATTCTTCCCATCGGGGACGGTGTCCTTGTCAGTGATCCCCTTGATGCACCGACAACTAACAGTGTTAATTCGT
AAGTAATCCAATCATATAGAGAAGCAGTGCTCTCACATATGGCGGTAGGATTATTGCGAATGTCGAAGGTTGTGT
TCCGCTTAGTGGAGCTAACCGCAAACCACAGTTCGTTCTTCTTGACTATGTGGATATTGGAAATGCTTTTCAAGC
GGCCAATCAATTAAATGGTTTAGCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail