Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|022640
Gene name
Locationscaffold_11:303512..305135
Strand+
Gene length (bp)1623
Transcript length (bp)1467
Coding sequence length (bp)1467
Protein length (aa) 489

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00646 F-box F-box domain 1.4E-04 4 28

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5693 0.4275 0.1501 0.0322 0.2289 0.0093 0.1607 0.2766 0.3031 0.0272

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup1119
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|022780
Agaricus bisporus var bisporus H39 AgabiH39|022890
Agaricus bisporus var bisporus H39 AgabiH39|022920
Agaricus bisporus var bisporus H39 AgabiH39|492900
Agaricus bisporus var bisporus H39 AgabiH39|493200
Agaricus bisporus var bisporus H39 AgabiH39|493500
Agaricus bisporus var bisporus H39 AgabiH39|493600
Agaricus bisporus var bisporus H97 AgabiH97|022890
Agaricus bisporus var bisporus H97 AgabiH97|022820
Agaricus bisporus var bisporus H97 AgabiH97|022810
Agaricus bisporus var bisporus H97 AgabiH97|022780
Agaricus bisporus var bisporus H97 AgabiH97|022620
Agaricus bisporus var bisporus H97 AgabiH97|022750
Agaricus bisporus var bisporus H97 AgabiH97|022640 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|022910
Agaricus bisporus var bisporus H97 AgabiH97|022610
Agaricus bisporus var bisporus H97 AgabiH97|022760
Agaricus bisporus var bisporus H97 AgabiH97|022920

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|022640
MLGDIPPEIVSEIVSHLPYKDIVALRQVFTCEDFCDATNAHAVWLNLAKQYLAENPHSHFSNMRSLSSLTRDQLR
ERFERRLMVNDLWQLSKGIYPSVKRLKELSSPILTISIAPGGRWLFAGTNKCSLYYWDLDSDNSEPVLLVPCDGI
GNIPGRNNTVAEIDFLVEHDDPLSGFIVVFIGMDGNIGKKSSEWLHIWDVIPQDDGALIAKRLKSLPMPYYGLYP
KLSFNDHLVARTMNERVDVYWWRECTDTRLVRCTLEFKRSILVSNLYVVSSDKLLVFTSFADKYKARLYALESGY
SEVEELAKVVSHATKIWSFRFSSEYHSRGISRLYFDGANYQQIIVMHGGICNLTIPALQADKATLTKVADFDLHQ
ERAHSQIYGLGFNKGYCRVGKELCRFGYSPGLTSGSYKCGAPVDRRLDRVLQTVESHPTFDEELGRLVTTYMNHL
VLHDFSLPLYNLADVNPDLNETKDEDAWNYWKPSVYKR*
Coding >AgabiH97|022640
ATGCTGGGCGACATACCACCCGAAATTGTGTCAGAAATTGTGTCGCATCTTCCCTATAAAGACATTGTTGCCCTT
CGCCAGGTCTTCACATGCGAGGACTTTTGTGACGCCACCAACGCCCACGCTGTATGGCTCAACCTCGCAAAGCAA
TATCTAGCAGAAAACCCTCATAGTCATTTTTCAAACATGCGATCTCTATCCTCTCTCACCAGAGACCAGCTCCGG
GAACGGTTCGAAAGACGACTTATGGTAAATGACCTCTGGCAACTATCAAAAGGAATCTATCCTTCTGTAAAGCGC
CTAAAAGAGCTTTCCTCCCCGATTTTGACTATAAGCATTGCTCCGGGTGGACGATGGTTGTTTGCTGGTACCAAC
AAATGCTCGTTATATTACTGGGACCTCGATTCCGACAACTCGGAGCCTGTACTCCTGGTGCCCTGTGATGGCATT
GGCAACATTCCCGGGAGGAACAATACAGTCGCTGAAATAGACTTTCTCGTCGAGCACGATGACCCCTTATCCGGG
TTCATTGTTGTATTCATTGGGATGGATGGTAACATTGGTAAGAAGTCATCAGAATGGCTTCATATTTGGGACGTC
ATACCACAAGATGATGGTGCTCTCATAGCCAAACGTCTAAAGAGTCTACCAATGCCGTACTATGGGCTTTATCCC
AAGTTATCATTCAATGACCACCTTGTTGCACGTACTATGAACGAGAGGGTGGATGTATACTGGTGGAGGGAGTGC
ACAGATACACGCTTAGTTAGGTGTACATTGGAATTTAAAAGGAGTATCCTTGTGTCTAATTTATATGTTGTCAGC
AGCGACAAACTTCTTGTCTTCACAAGTTTTGCGGACAAATATAAAGCACGCTTGTACGCCCTGGAGTCAGGATAT
TCTGAAGTCGAAGAACTTGCGAAGGTAGTATCGCATGCGACAAAAATCTGGTCATTTCGTTTCAGTTCCGAGTAC
CACAGCCGTGGGATATCACGATTATATTTCGATGGAGCAAACTATCAACAGATCATTGTTATGCATGGTGGCATC
TGTAATCTCACTATACCGGCATTGCAAGCCGACAAAGCGACTTTAACAAAGGTTGCAGATTTTGACCTTCATCAA
GAACGAGCCCACTCTCAAATATACGGCTTGGGCTTTAACAAAGGCTACTGTAGAGTGGGTAAGGAGCTGTGTAGG
TTTGGCTACTCGCCGGGTTTAACGAGCGGATCTTACAAATGTGGTGCACCAGTTGACCGGAGACTAGACCGTGTT
CTTCAAACCGTTGAAAGCCATCCTACCTTTGACGAGGAGCTGGGACGGCTGGTTACTACATACATGAATCACCTT
GTTCTTCATGACTTTTCTCTCCCATTGTATAATCTTGCAGATGTAAACCCGGACTTGAATGAAACTAAAGACGAA
GACGCGTGGAACTACTGGAAGCCCTCTGTATATAAAAGGTAG
Transcript >AgabiH97|022640
ATGCTGGGCGACATACCACCCGAAATTGTGTCAGAAATTGTGTCGCATCTTCCCTATAAAGACATTGTTGCCCTT
CGCCAGGTCTTCACATGCGAGGACTTTTGTGACGCCACCAACGCCCACGCTGTATGGCTCAACCTCGCAAAGCAA
TATCTAGCAGAAAACCCTCATAGTCATTTTTCAAACATGCGATCTCTATCCTCTCTCACCAGAGACCAGCTCCGG
GAACGGTTCGAAAGACGACTTATGGTAAATGACCTCTGGCAACTATCAAAAGGAATCTATCCTTCTGTAAAGCGC
CTAAAAGAGCTTTCCTCCCCGATTTTGACTATAAGCATTGCTCCGGGTGGACGATGGTTGTTTGCTGGTACCAAC
AAATGCTCGTTATATTACTGGGACCTCGATTCCGACAACTCGGAGCCTGTACTCCTGGTGCCCTGTGATGGCATT
GGCAACATTCCCGGGAGGAACAATACAGTCGCTGAAATAGACTTTCTCGTCGAGCACGATGACCCCTTATCCGGG
TTCATTGTTGTATTCATTGGGATGGATGGTAACATTGGTAAGAAGTCATCAGAATGGCTTCATATTTGGGACGTC
ATACCACAAGATGATGGTGCTCTCATAGCCAAACGTCTAAAGAGTCTACCAATGCCGTACTATGGGCTTTATCCC
AAGTTATCATTCAATGACCACCTTGTTGCACGTACTATGAACGAGAGGGTGGATGTATACTGGTGGAGGGAGTGC
ACAGATACACGCTTAGTTAGGTGTACATTGGAATTTAAAAGGAGTATCCTTGTGTCTAATTTATATGTTGTCAGC
AGCGACAAACTTCTTGTCTTCACAAGTTTTGCGGACAAATATAAAGCACGCTTGTACGCCCTGGAGTCAGGATAT
TCTGAAGTCGAAGAACTTGCGAAGGTAGTATCGCATGCGACAAAAATCTGGTCATTTCGTTTCAGTTCCGAGTAC
CACAGCCGTGGGATATCACGATTATATTTCGATGGAGCAAACTATCAACAGATCATTGTTATGCATGGTGGCATC
TGTAATCTCACTATACCGGCATTGCAAGCCGACAAAGCGACTTTAACAAAGGTTGCAGATTTTGACCTTCATCAA
GAACGAGCCCACTCTCAAATATACGGCTTGGGCTTTAACAAAGGCTACTGTAGAGTGGGTAAGGAGCTGTGTAGG
TTTGGCTACTCGCCGGGTTTAACGAGCGGATCTTACAAATGTGGTGCACCAGTTGACCGGAGACTAGACCGTGTT
CTTCAAACCGTTGAAAGCCATCCTACCTTTGACGAGGAGCTGGGACGGCTGGTTACTACATACATGAATCACCTT
GTTCTTCATGACTTTTCTCTCCCATTGTATAATCTTGCAGATGTAAACCCGGACTTGAATGAAACTAAAGACGAA
GACGCGTGGAACTACTGGAAGCCCTCTGTATATAAAAGGTAG
Gene >AgabiH97|022640
ATGCTGGGCGACATACCACCCGAAATTGTGTCAGAAATTGTGTCGCATCTTCCCTATAAAGACATTGTTGCCCTT
CGCCAGGTGAGTATTTCGTCTTATCTTTTCACCATATCAGTATTAATACATTATTCAGGTCTTCACATGCGAGGA
CTTTTGTGACGCCACCAACGCCCACGCTGTATGGCTCAACCTCGCAAAGCAATATCTAGCAGAAAACCCTCATAG
TCATTTTTCAAACATGCGATCTCTATCCTCTCTCACCAGAGACCAGCTCCGGGAACGGTTCGAAAGACGACTTAT
GGTAAATGACCTCTGGCAACTATCAAAAGGAATCTATCCTTCTGTAAAGCGCCTAAAAGAGCTTTCCTCCCCGAT
TTTGACTATAAGCATTGCTCCGGGTGGACGATGGTTGTTTGCTGGTACCAACAAATGCTCGTTATATTACTGGGA
CCTCGATTCCGACAACTCGGAGCCTGTACTCCTGGTGCCCTGTGATGGCATTGGCAACATTCCCGGGAGGAACAA
TACAGTCGCTGAAATAGACTTTCTCGTCGAGCACGATGACCCCTTATCCGGGTTCATTGTTGTATTCATTGGGAT
GGATGGTAAGTCTCTGATTACATCGTATATGGGAAGAACTGATAGACGGCAATTTCAGGTAACATTGGTAAGAAG
TCATCAGAATGGCTTCATATTTGGGACGTCATACCACAAGATGATGGTGCTCTCATAGCCAAACGTCTAAAGAGT
CTACCAATGCCGTACTATGGGCTTTATCCCAAGTTATCATTCAATGACCACCTTGTTGCACGTACTATGAACGAG
AGGGTGGATGTATACTGGTGGAGGGAGTGCACAGATACACGCTTAGTTAGGTGTACATTGGAATTTAAAAGGAGT
ATCCTTGTGGTGCGTAATATGTTCTATCCCAATACGACTTCAACGTTGATTATTCCTCAGTCTAATTTATATGTT
GTCAGCAGCGACAAACTTCTTGTCTTCACAAGTTTTGCGGACAAATATAAAGCACGCTTGTACGCCCTGGAGTCA
GGATATTCTGAAGTCGAAGAACTTGCGAAGGTAGTATCGCATGCGACAAAAATCTGGTCATTTCGTTTCAGTTCC
GAGTACCACAGCCGTGGGATATCACGATTATATTTCGATGGAGCAAACTATCAACAGATCATTGTTATGCATGGT
GGCATCTGTAATCTCACTATACCGGCATTGCAAGCCGACAAAGCGACTTTAACAAAGGTTGCAGATTTTGACCTT
CATCAAGAACGAGCCCACTCTCAAATATACGGCTTGGGCTTTAACAAAGGCTACTGTAGAGTGGGTAAGGAGCTG
TGTAGGTTTGGCTACTCGCCGGGTTTAACGAGCGGATCTTACAAATGTGGTGCACCAGTTGACCGGAGACTAGAC
CGTGTTCTTCAAACCGTTGAAAGCCATCCTACCTTTGACGAGGAGCTGGGACGGCTGGTTACTACATACATGAAT
CACCTTGTTCTTCATGACTTTTCTCTCCCATTGTATAATCTTGCAGATGTAAACCCGGACTTGAATGAAACTAAA
GACGAAGACGCGTGGAACTACTGGAAGCCCTCTGTATATAAAAGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail