Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|022580
Gene name
Locationscaffold_11:284290..285568
Strand-
Gene length (bp)1278
Transcript length (bp)849
Coding sequence length (bp)849
Protein length (aa) 283

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1) 1.5E-13 70 266

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4B4V1|PMU1_ARTBC Probable phosphoglycerate mutase ARB_03491 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03491 PE=1 SV=1 1 278 1.0E-49
sp|Q5ACP5|PGA12_CANAL Phosphomutase-like protein 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PGA12 PE=1 SV=1 15 277 2.0E-38
sp|P36069|PMU1_YEAST Probable phosphoglycerate mutase PMU1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMU1 PE=1 SV=1 67 270 7.0E-19
sp|Q9FGF0|PGML1_ARATH Phosphoglycerate mutase-like protein 1 OS=Arabidopsis thaliana GN=At5g64460 PE=2 SV=1 63 232 1.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|022580
MTISSVNESAVQRCYQAVDGFFMQDTPTQGHSIRSFFGLIDDSAERWLNLEKHLQDLNANAQPGESYKLFYFYRH
GQSYHNVGKDKYASNEWKGHWGRQNGDDEITWGPDSDLTPAGIAQALRIKEEWDKERDFGIPCPEKIYTSPLTRA
LKTCDIAFDWIINKQKSVLVVENCREGNGVYSYDMRRQRSWIQTHFPKFQIEEEFSEEDELWVPDVRETKEAIAA
RARSVLDKVFDEEPQITYVCFTIHGGIINAFLSILGLPKQSLSTGGVFPVIIRGYLD*
Coding >AgabiH97|022580
ATGACCATCTCGTCGGTGAATGAATCCGCCGTACAGCGGTGTTATCAGGCGGTAGACGGATTCTTCATGCAGGAC
ACCCCGACCCAGGGACACTCAATTCGATCATTCTTTGGCCTAATAGACGACTCTGCAGAAAGGTGGCTAAATCTC
GAAAAGCACCTTCAGGATCTCAATGCGAACGCCCAACCCGGAGAATCATACAAGCTCTTTTACTTCTATAGGCAC
GGGCAGAGCTACCATAACGTCGGTAAGGATAAGTACGCTTCTAATGAATGGAAAGGCCATTGGGGGAGACAGAAC
GGCGACGATGAGATCACCTGGGGGCCTGACTCTGATCTCACCCCGGCTGGAATTGCCCAGGCATTGCGTATCAAA
GAAGAATGGGACAAAGAACGCGATTTTGGCATTCCTTGTCCAGAGAAGATTTACACAAGTCCTCTCACTCGAGCG
CTCAAGACATGTGACATCGCATTTGATTGGATAATAAACAAACAGAAGTCGGTCCTCGTTGTGGAAAATTGCAGG
GAAGGAAATGGGGTATACTCATATGACATGAGACGCCAGAGAAGCTGGATACAGACGCATTTTCCAAAGTTTCAG
ATAGAAGAAGAATTCTCTGAAGAGGATGAACTCTGGGTCCCGGACGTCAGGGAGACAAAGGAAGCAATAGCAGCG
CGGGCACGATCAGTTTTGGATAAGGTTTTCGATGAAGAGCCTCAAATAACATATGTGTGCTTTACGATACACGGA
GGGATCATTAATGCCTTTTTATCTATTTTAGGTCTTCCAAAACAGTCGTTATCCACCGGAGGGGTTTTTCCAGTG
ATTATTAGAGGATATCTAGATTAG
Transcript >AgabiH97|022580
ATGACCATCTCGTCGGTGAATGAATCCGCCGTACAGCGGTGTTATCAGGCGGTAGACGGATTCTTCATGCAGGAC
ACCCCGACCCAGGGACACTCAATTCGATCATTCTTTGGCCTAATAGACGACTCTGCAGAAAGGTGGCTAAATCTC
GAAAAGCACCTTCAGGATCTCAATGCGAACGCCCAACCCGGAGAATCATACAAGCTCTTTTACTTCTATAGGCAC
GGGCAGAGCTACCATAACGTCGGTAAGGATAAGTACGCTTCTAATGAATGGAAAGGCCATTGGGGGAGACAGAAC
GGCGACGATGAGATCACCTGGGGGCCTGACTCTGATCTCACCCCGGCTGGAATTGCCCAGGCATTGCGTATCAAA
GAAGAATGGGACAAAGAACGCGATTTTGGCATTCCTTGTCCAGAGAAGATTTACACAAGTCCTCTCACTCGAGCG
CTCAAGACATGTGACATCGCATTTGATTGGATAATAAACAAACAGAAGTCGGTCCTCGTTGTGGAAAATTGCAGG
GAAGGAAATGGGGTATACTCATATGACATGAGACGCCAGAGAAGCTGGATACAGACGCATTTTCCAAAGTTTCAG
ATAGAAGAAGAATTCTCTGAAGAGGATGAACTCTGGGTCCCGGACGTCAGGGAGACAAAGGAAGCAATAGCAGCG
CGGGCACGATCAGTTTTGGATAAGGTTTTCGATGAAGAGCCTCAAATAACATATGTGTGCTTTACGATACACGGA
GGGATCATTAATGCCTTTTTATCTATTTTAGGTCTTCCAAAACAGTCGTTATCCACCGGAGGGGTTTTTCCAGTG
ATTATTAGAGGATATCTAGATTAG
Gene >AgabiH97|022580
ATGACCATCTCGTCGGTGAATGAATCCGCCGTACAGCGGTGTTATCAGGTAAAGTTCGTTAATGAACCCTGTGAT
TTTTCTCTGACCATGGGAAGGCGGTAGACGGATTCTTCATGCAGGACACCCCGACCCAGGGACACTCAGTAATCC
GCATTCCTGTCCGAAGGGAAAACGGAAACTCGCTCACCCAACACCACCAGATTCGATCATTCTTTGGCCTAATAG
ACGACTCTGCAGAAAGGTGGCTAAATCTCGAAAAGCACCTTCAGGATCTCAATGCGAACGCCCAACCCGGAGAAT
CATACAAGCTCTTTTACTTCTATAGGCACGGGCAGAGCTACCGTGCGTGTGGTTGTTTTATTCATGGACAGATCT
TATACTATCGCCTAGATAACGTCGGTAAGGATAAGTACGCTTCTAATGAATGGAAAGGGTGAGTGTGTTCAAAAT
GACGACATTCCACATATGCTAATGTTCTACTTTGGGGCTATCAGCCATTGGGGGAGACAGAACGGCGACGATGAG
ATCACCTGGGGGCGTAAGCATGAACTTCCTTTTGACAAGCCGATCCACGGCTCTGAATCGCTCTTCCAGCTGACT
CTGATCTCACCCCGGCTGGAATTGCCCAGGCATTGCGTATCAAAGAAGAATGGGACAAAGAACGCGATTTTGGCA
TTCCTTGTCCAGAGAAGATTTACACAAGTCCTCTCACTCGAGCGCTCAAGACATGTGACATCGCATTTGATTGGA
TAATAAACAAACAGAAGTCGGTCCTCGTTGTGGAAGTTAGTGCTTCTTCGCTGCAAGATGAAAACAGTGCCTTGA
CCAAAGTCATGTAGAATTGCAGGGAAGGAAATGGGGTATACTCATATGACATGAGACGCCAGAGAAGCTGGATAC
AGACGCATTTTCCAAAGTTTCAGATAGAAGAAGAATTCTCTGAAGAGGATGAACTCTGGGTCCCGGACGTCAGGG
AGACAAAGGAAGCAATAGCAGCGCGGGCACGATCAGTTTTGGATAAGGTTTTCGATGAAGAGCCTCAAATAACAT
GTGAGAGCAAGCTGTTAGTTTAGTTGGAATCATGACATTGAACGTCTAATAGATGTGTGCTTTACGATACACGGA
GGGATCATTAATGCCTTTTTATCTATTTTAGGTCTTCCAAAACAGTCGTTATCCACCGGAGGTATGCATCTTTTG
TCAAAAGGGGCCGTCTCAGCCATGCTAACGGACTCCGTAGGGGTTTTTCCAGTGATTATTAGAGGATATCTAGAT
TAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail