Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|022570
Gene name
Locationscaffold_11:280262..281583
Strand-
Gene length (bp)1321
Transcript length (bp)1095
Coding sequence length (bp)1095
Protein length (aa) 365

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19086 Terpene_syn_C_2 Terpene synthase family 2, C-terminal metal binding 1.3E-34 83 269
PF03936 Terpene_synth_C Terpene synthase family, metal binding domain 8.3E-07 148 267

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0DL13|PRO1_ARMGA Delta(6)-protoilludene synthase OS=Armillaria gallica GN=PRO1 PE=1 SV=1 14 338 3.0E-75
sp|A8NE23|COP3_COPC7 Alpha-muurolene synthase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=COP3 PE=1 SV=1 10 336 4.0E-42
sp|A8NU13|COP4_COPC7 Linoleate 10R-lipoxygenase COP4 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=COP4 PE=1 SV=1 13 337 8.0E-37
sp|Q6WP50|BOT2_BOTFU Presilphiperfolan-8-beta-ol synthase OS=Botryotinia fuckeliana GN=BOT2 PE=1 SV=1 28 337 4.0E-18
sp|Q55012|PENA_STREX Pentalenene synthase OS=Streptomyces exfoliatus GN=penA PE=1 SV=4 23 319 9.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0DL13|PRO1_ARMGA Delta(6)-protoilludene synthase OS=Armillaria gallica GN=PRO1 PE=1 SV=1 14 338 3.0E-75
sp|A8NE23|COP3_COPC7 Alpha-muurolene synthase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=COP3 PE=1 SV=1 10 336 4.0E-42
sp|A8NU13|COP4_COPC7 Linoleate 10R-lipoxygenase COP4 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=COP4 PE=1 SV=1 13 337 8.0E-37
sp|Q6WP50|BOT2_BOTFU Presilphiperfolan-8-beta-ol synthase OS=Botryotinia fuckeliana GN=BOT2 PE=1 SV=1 28 337 4.0E-18
sp|Q55012|PENA_STREX Pentalenene synthase OS=Streptomyces exfoliatus GN=penA PE=1 SV=4 23 319 9.0E-17
sp|E3VWJ0|PNTA_STRAE Pentalenene synthase OS=Streptomyces arenae GN=pntA PE=3 SV=1 23 319 7.0E-16
sp|B2J4A4|GERAS_NOSP7 Germacrene A synthase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=Npun_R3832 PE=1 SV=1 53 319 9.0E-15
sp|Q82IY4|PTLA_STRAW Pentalenene synthase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlA PE=1 SV=1 23 319 2.0E-14
sp|J9R393|MTS13_SELML Microbial Terpene synthase-like protein 13 OS=Selaginella moellendorffii GN=SELMODRAFT_412537 PE=2 SV=2 27 321 4.0E-12
sp|Q9X839|CYC2_STRCO Germacradienol/geosmin synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=cyc2 PE=1 SV=3 123 277 4.0E-09
sp|J9R1J8|MTS1_SELML Microbial Terpene synthase-like protein 1 OS=Selaginella moellendorffii GN=SELMODRAFT_402353 PE=1 SV=2 28 321 6.0E-09
sp|Q03471|ARIS_PENRO Aristolochene synthase OS=Penicillium roqueforti GN=ARI1 PE=1 SV=1 20 319 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0010333 terpene synthase activity Yes
GO:0000287 magnesium ion binding Yes
GO:0016829 lyase activity Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0016838 carbon-oxygen lyase activity, acting on phosphates No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0016835 carbon-oxygen lyase activity No
GO:0003824 catalytic activity No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|022570
MVQTSAHNQPIDFLLPDFLAQWPYERRLHPDYGTVDVESAVWVNEHQFFVAKAQKSFDASRFGLLGCLIFPLNTK
DFCRTGCDLANVYFVIDEFTDVAEPQAAAQVCDGVMDVLRNPYKERNPGDKLGIFMQEFWQRALNLTDPGAACVK
HFIDGFDLYMKSMIQESEDRESKRVRPIDDYLQLRRETFGAQATIALLGFGLEIPEDVLSHPVMESMLLAAMDLL
CITNDMHSYSIELARGIAFHNIVSSIILEHGLSVPAAMSWLEDFGKSRVKVFLDGVEKLPSWGPEIDGRVREYID
SVGYLVRGADAWSYESERYWGNKGQEVQRTRVVTIVPKDSQQGLVTREELEATMQYTHTNELLV*
Coding >AgabiH97|022570
ATGGTTCAAACCTCCGCTCACAACCAACCCATTGATTTCTTGTTGCCCGACTTCTTGGCCCAGTGGCCCTACGAA
CGACGTCTGCATCCCGATTATGGGACTGTCGATGTTGAGAGTGCCGTTTGGGTAAATGAACACCAGTTCTTCGTT
GCGAAGGCACAAAAATCCTTCGACGCATCCCGCTTTGGTCTTTTGGGTTGTCTTATCTTTCCGCTAAACACCAAA
GATTTCTGTCGCACAGGCTGCGATTTAGCAAATGTTTACTTCGTCATTGATGAATTCACCGACGTCGCTGAACCT
CAGGCTGCGGCTCAAGTCTGCGATGGTGTGATGGATGTTCTCCGTAACCCGTATAAGGAGAGAAACCCAGGAGAC
AAATTGGGAATTTTCATGCAAGAGTTTTGGCAGCGGGCCCTCAACCTTACTGATCCAGGCGCCGCATGCGTCAAG
CACTTCATCGACGGTTTCGATTTATACATGAAGTCCATGATACAAGAATCAGAAGATCGTGAATCAAAGCGCGTT
CGACCTATCGATGACTATTTGCAGCTCCGCCGAGAGACTTTTGGTGCACAGGCAACCATTGCGCTTCTCGGATTT
GGATTAGAAATTCCTGAAGACGTGCTTTCTCACCCTGTCATGGAAAGCATGCTACTAGCTGCCATGGACCTCTTA
TGCATAACTAACGACATGCATTCGTATTCAATAGAGCTTGCACGTGGAATTGCCTTCCACAATATTGTTTCTTCC
ATCATCTTAGAGCATGGGTTGAGCGTCCCTGCGGCTATGAGTTGGCTAGAGGATTTTGGAAAATCCAGAGTCAAG
GTATTTTTGGACGGTGTGGAGAAATTGCCGTCTTGGGGTCCGGAGATTGACGGCCGTGTACGAGAGTATATCGAT
TCCGTTGGGTATCTCGTCCGGGGCGCCGATGCATGGAGTTACGAATCGGAGAGGTACTGGGGAAACAAAGGTCAA
GAAGTTCAACGGACCCGAGTGGTCACAATCGTCCCAAAGGATAGCCAACAGGGTTTGGTTACGCGTGAAGAACTC
GAAGCTACGATGCAGTATACACATACAAATGAGTTGTTGGTATAA
Transcript >AgabiH97|022570
ATGGTTCAAACCTCCGCTCACAACCAACCCATTGATTTCTTGTTGCCCGACTTCTTGGCCCAGTGGCCCTACGAA
CGACGTCTGCATCCCGATTATGGGACTGTCGATGTTGAGAGTGCCGTTTGGGTAAATGAACACCAGTTCTTCGTT
GCGAAGGCACAAAAATCCTTCGACGCATCCCGCTTTGGTCTTTTGGGTTGTCTTATCTTTCCGCTAAACACCAAA
GATTTCTGTCGCACAGGCTGCGATTTAGCAAATGTTTACTTCGTCATTGATGAATTCACCGACGTCGCTGAACCT
CAGGCTGCGGCTCAAGTCTGCGATGGTGTGATGGATGTTCTCCGTAACCCGTATAAGGAGAGAAACCCAGGAGAC
AAATTGGGAATTTTCATGCAAGAGTTTTGGCAGCGGGCCCTCAACCTTACTGATCCAGGCGCCGCATGCGTCAAG
CACTTCATCGACGGTTTCGATTTATACATGAAGTCCATGATACAAGAATCAGAAGATCGTGAATCAAAGCGCGTT
CGACCTATCGATGACTATTTGCAGCTCCGCCGAGAGACTTTTGGTGCACAGGCAACCATTGCGCTTCTCGGATTT
GGATTAGAAATTCCTGAAGACGTGCTTTCTCACCCTGTCATGGAAAGCATGCTACTAGCTGCCATGGACCTCTTA
TGCATAACTAACGACATGCATTCGTATTCAATAGAGCTTGCACGTGGAATTGCCTTCCACAATATTGTTTCTTCC
ATCATCTTAGAGCATGGGTTGAGCGTCCCTGCGGCTATGAGTTGGCTAGAGGATTTTGGAAAATCCAGAGTCAAG
GTATTTTTGGACGGTGTGGAGAAATTGCCGTCTTGGGGTCCGGAGATTGACGGCCGTGTACGAGAGTATATCGAT
TCCGTTGGGTATCTCGTCCGGGGCGCCGATGCATGGAGTTACGAATCGGAGAGGTACTGGGGAAACAAAGGTCAA
GAAGTTCAACGGACCCGAGTGGTCACAATCGTCCCAAAGGATAGCCAACAGGGTTTGGTTACGCGTGAAGAACTC
GAAGCTACGATGCAGTATACACATACAAATGAGTTGTTGGTATAA
Gene >AgabiH97|022570
ATGGTTCAAACCTCCGCTCACAACCAACCCATTGATTTCTTGTTGCCCGACTTCTTGGCCCAGTGGCCCTACGAA
CGACGTCTGCATCCCGATTATGGGACTGTCGATGTTGAGAGTGCCGTTTGGGTAAATGAACACCAGTTCTTCGTT
GCGAAGGCACAAAAATCCTTCGACGCATCCCGCTTTGGTCAGTGTGGTTACTATCACATAAACATTTCCCCAAAC
TGATCTTGTGATTTCGATATAAAGGTCTTTTGGGTTGTCTTATCTTTCCGCTAAACACCAAAGGTACGTTTTACC
AAGTTGATCATCAACGCGAGTGGACGCTCACAAACATTTGTCAGATTTCTGTCGCACAGGCTGCGATTTAGCAAA
TGTTTACTTCGTCATTGATGAATTCACCGACGTCGCTGAACCTCAGGCTGCGGCTCAAGTCTGCGATGGTGTGAT
GGATGTTCTCCGTAACCCGTATAAGGAGAGAAACCCAGGAGACAAATTGGGAATTTTCATGCAAGAGTAAATTGG
TCCCTGCTATGGGTCAACAGTATCTGACATCCTTCGCAGGTTTTGGCAGCGGGCCCTCAACCTTACTGATCCAGG
CGCCGCATGCGTCAAGCACTTCATCGACGGTTTCGATTTATACATGAAGTCCATGATACAAGAATCAGAAGATCG
TGAATCAAAGCGCGTTCGACCTATCGATGACTATTTGCAGCTCCGCCGAGAGACTTTTGGTGCACAGGCAACCAT
TGCGCTTCTCGGATTTGGATTAGAAATTCCTGAAGACGTGCTTTCTCACCCTGTCATGGAAAGCATGCTACTAGC
TGCCATGGACCTCTTATGCATAACTAACGTGAGCACTTCATTGATCAAAGATCAAGCTCGCGAACGGTTCTAATA
GCTACTTCCACAGGACATGCATTCGTATTCAATAGAGCTTGCACGTGGAATTGCCTTCCACAATATTGTTTCTTC
CATCATCTTAGAGCATGGGTTGAGCGTCCCTGCGGCTATGAGTTGGCTAGAGGATTTTGGAAAATCCAGAGTCAA
GGTATTTTTGGACGGTGTGGAGAAATTGCCGTCTTGGGGTCCGGAGATTGACGGCCGTGTACGAGAGTATATCGA
TTCCGTTGGGTATCTCGTCCGGGGCGCCGATGCATGGAGTTACGAATCGGAGAGGTACTGGGGAAACAAAGGTCA
AGAAGTTCAACGGACCCGAGTGGTCACAATCGTCCCAAAGGATAGCCAACAGGGTTTGGTTACGCGTGAAGAACT
CGAAGCTACGATGCAGTATACACATACAAATGAGTTGTTGGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail