Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|022370
Gene name
Locationscaffold_11:237319..238501
Strand+
Gene length (bp)1182
Transcript length (bp)738
Coding sequence length (bp)738
Protein length (aa) 246

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 127.65 75.66 179.65
Initials Initials knots 93.09 54.32 131.87
Pileal_Stipeal_center Stage I stipe center 56.53 31.66 81.40
Pileal_Stipeal_shell Stage I stipe shell 50.52 27.88 73.17
DIF_stipe_center Stage II stipe center 59.14 33.16 85.11
DIF_stipe_shell Stage II stipe shell 70.12 40.16 100.08
DIF_stipe_skin Stage II stipe skin 50.48 27.53 73.44
DIF_cap_skin Stage II cap skin 39.72 21.25 58.19
DIF_cap_tissue Stage II cap tissue 34.55 18.18 50.93
DIF_gill_tissue Stage II gill tissue 48.16 26.45 69.87
YFB_stipe_center Young fruiting body stipe center 63.03 34.22 91.84
YFB_stipe_shell Young fruiting body stipe shell 111.34 66.06 156.63
YFB_stipe_skin Young fruiting body stipe skin 72.21 41.36 103.06
YFB_cap_skin Young fruiting body cap skin 41.78 22.53 61.02
YFB_cap_tissue Young fruiting body cap tissue 38.37 20.35 56.39
YFB_gill_tissue Young fruiting body gill tissue 86.20 49.45 122.94
YFB_veil Young fruiting body veil 67.71 36.33 99.10

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.009773 yes
Casing YFB_stipe_shell 0.749575 no
Casing YFB_stipe_skin 0.032266 yes
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.190974 no
Casing YFB_veil 0.022892 yes
Casing Initials 0.318785 no
Casing Pileal_Stipeal_center 0.001140 yes
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.002084 yes
Casing DIF_stipe_shell 0.024946 yes
Casing DIF_stipe_skin 0.001140 yes
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.482816 no
DIF_gill_tissue YFB_stipe_shell 0.000613 yes
DIF_gill_tissue YFB_stipe_skin 0.205647 no
DIF_gill_tissue YFB_cap_skin 0.769029 no
DIF_gill_tissue YFB_cap_tissue 0.586660 no
DIF_gill_tissue YFB_gill_tissue 0.042041 yes
DIF_gill_tissue YFB_veil 0.331609 no
YFB_stipe_center YFB_stipe_shell 0.048212 yes
YFB_stipe_center YFB_stipe_skin 0.780875 no
YFB_stipe_center YFB_cap_skin 0.238543 no
YFB_stipe_center YFB_cap_tissue 0.136458 no
YFB_stipe_center YFB_gill_tissue 0.387851 no
YFB_stipe_center YFB_veil 0.899698 no
YFB_stipe_shell YFB_stipe_skin 0.141536 no
YFB_stipe_shell YFB_cap_skin 0.000613 yes
YFB_stipe_shell YFB_cap_tissue 0.000613 yes
YFB_stipe_shell YFB_gill_tissue 0.467739 no
YFB_stipe_shell YFB_veil 0.092841 no
YFB_stipe_skin YFB_cap_skin 0.068081 no
YFB_stipe_skin YFB_cap_tissue 0.033444 yes
YFB_stipe_skin YFB_gill_tissue 0.670953 no
YFB_stipe_skin YFB_veil 0.906383 no
YFB_cap_skin YFB_cap_tissue 0.884579 no
YFB_cap_skin YFB_gill_tissue 0.013485 yes
YFB_cap_skin YFB_veil 0.136741 no
YFB_cap_tissue YFB_gill_tissue 0.006032 yes
YFB_cap_tissue YFB_veil 0.075382 no
YFB_gill_tissue YFB_veil 0.533406 no
Initials DIF_gill_tissue 0.014668 yes
Initials YFB_stipe_center 0.227594 no
Initials YFB_stipe_shell 0.655730 no
Initials YFB_stipe_skin 0.480754 no
Initials YFB_cap_skin 0.003765 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.884007 no
Initials YFB_veil 0.357885 no
Initials Pileal_Stipeal_center 0.083843 no
Initials Pileal_Stipeal_shell 0.027943 yes
Initials DIF_stipe_center 0.127489 no
Initials DIF_stipe_shell 0.412526 no
Initials DIF_stipe_skin 0.031800 yes
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.723223 no
Pileal_Stipeal_center YFB_stipe_center 0.835679 no
Pileal_Stipeal_center YFB_stipe_shell 0.011968 yes
Pileal_Stipeal_center YFB_stipe_skin 0.514796 no
Pileal_Stipeal_center YFB_cap_skin 0.419555 no
Pileal_Stipeal_center YFB_cap_tissue 0.263795 no
Pileal_Stipeal_center YFB_gill_tissue 0.171663 no
Pileal_Stipeal_center YFB_veil 0.681460 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.824078 no
Pileal_Stipeal_center DIF_stipe_center 0.938213 no
Pileal_Stipeal_center DIF_stipe_shell 0.589565 no
Pileal_Stipeal_center DIF_stipe_skin 0.824701 no
Pileal_Stipeal_center DIF_cap_skin 0.308718 no
Pileal_Stipeal_center DIF_cap_tissue 0.116723 no
Pileal_Stipeal_shell DIF_gill_tissue 0.934353 no
Pileal_Stipeal_shell YFB_stipe_center 0.600056 no
Pileal_Stipeal_shell YFB_stipe_shell 0.002951 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.287100 no
Pileal_Stipeal_shell YFB_cap_skin 0.672072 no
Pileal_Stipeal_shell YFB_cap_tissue 0.489586 no
Pileal_Stipeal_shell YFB_gill_tissue 0.069387 no
Pileal_Stipeal_shell YFB_veil 0.436004 no
Pileal_Stipeal_shell DIF_stipe_center 0.733131 no
Pileal_Stipeal_shell DIF_stipe_shell 0.340799 no
Pileal_Stipeal_shell DIF_stipe_skin 0.998365 no
Pileal_Stipeal_shell DIF_cap_skin 0.555900 no
Pileal_Stipeal_shell DIF_cap_tissue 0.283077 no
DIF_stipe_center DIF_gill_tissue 0.617784 no
DIF_stipe_center YFB_stipe_center 0.911177 no
DIF_stipe_center YFB_stipe_shell 0.020790 yes
DIF_stipe_center YFB_stipe_skin 0.619299 no
DIF_stipe_center YFB_cap_skin 0.329846 no
DIF_stipe_center YFB_cap_tissue 0.197111 no
DIF_stipe_center YFB_gill_tissue 0.247368 no
DIF_stipe_center YFB_veil 0.774765 no
DIF_stipe_center DIF_stipe_shell 0.690658 no
DIF_stipe_center DIF_stipe_skin 0.730845 no
DIF_stipe_center DIF_cap_skin 0.234076 no
DIF_stipe_center DIF_cap_tissue 0.083158 no
DIF_stipe_shell DIF_gill_tissue 0.250478 no
DIF_stipe_shell YFB_stipe_center 0.835679 no
DIF_stipe_shell YFB_stipe_shell 0.112576 no
DIF_stipe_shell YFB_stipe_skin 0.960236 no
DIF_stipe_shell YFB_cap_skin 0.095962 no
DIF_stipe_shell YFB_cap_tissue 0.042041 yes
DIF_stipe_shell YFB_gill_tissue 0.602108 no
DIF_stipe_shell YFB_veil 0.951906 no
DIF_stipe_shell DIF_stipe_skin 0.354742 no
DIF_stipe_shell DIF_cap_skin 0.057550 no
DIF_stipe_shell DIF_cap_tissue 0.011968 yes
DIF_stipe_skin DIF_gill_tissue 0.937016 no
DIF_stipe_skin YFB_stipe_center 0.606119 no
DIF_stipe_skin YFB_stipe_shell 0.004160 yes
DIF_stipe_skin YFB_stipe_skin 0.297869 no
DIF_stipe_skin YFB_cap_skin 0.682175 no
DIF_stipe_skin YFB_cap_tissue 0.501161 no
DIF_stipe_skin YFB_gill_tissue 0.074840 no
DIF_stipe_skin YFB_veil 0.444640 no
DIF_stipe_skin DIF_cap_skin 0.564266 no
DIF_stipe_skin DIF_cap_tissue 0.297207 no
DIF_cap_skin DIF_gill_tissue 0.657845 no
DIF_cap_skin YFB_stipe_center 0.154913 no
DIF_cap_skin YFB_stipe_shell 0.000613 yes
DIF_cap_skin YFB_stipe_skin 0.042041 yes
DIF_cap_skin YFB_cap_skin 0.934603 no
DIF_cap_skin YFB_cap_tissue 0.956458 no
DIF_cap_skin YFB_gill_tissue 0.005302 yes
DIF_cap_skin YFB_veil 0.090658 no
DIF_cap_skin DIF_cap_tissue 0.781076 no
DIF_cap_tissue DIF_gill_tissue 0.361624 no
DIF_cap_tissue YFB_stipe_center 0.055381 no
DIF_cap_tissue YFB_stipe_shell 0.000613 yes
DIF_cap_tissue YFB_stipe_skin 0.011968 yes
DIF_cap_tissue YFB_cap_skin 0.683743 no
DIF_cap_tissue YFB_cap_tissue 0.851237 no
DIF_cap_tissue YFB_gill_tissue 0.001140 yes
DIF_cap_tissue YFB_veil 0.029408 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|022370
MYSSFFTLILAVAGSVVNALPTADAPALVPRDCSAEVAALNMKRAEKRGLDARSVWPGPQNTTCVLAPESPKENY
VAGMPARSDIAGGQDGLEFVLDVAVMDVTTCKVLPNTMVELWSPNAMGQYGNFLRGGTTTSSGGIAEFRTIYPGM
SKGANHVNIAVHTSSSMSSSTTHVGKLFFVDRWNELILGTSPYTQNSNPKVLDNQDADYRNAVSKGYSPVISITS
IHDDWPEGVVGIVTVGVNPH*
Coding >AgabiH97|022370
ATGTACTCCAGTTTCTTCACTCTCATCCTCGCCGTCGCTGGCTCGGTTGTTAATGCCCTCCCAACGGCTGATGCC
CCAGCGCTGGTTCCGCGTGATTGCTCTGCTGAAGTAGCTGCGCTCAACATGAAGCGCGCTGAGAAACGTGGTCTC
GATGCACGTTCAGTCTGGCCCGGTCCTCAGAACACGACATGCGTTCTTGCCCCCGAATCACCCAAAGAAAATTAC
GTCGCTGGAATGCCTGCCAGATCCGACATTGCCGGCGGACAAGATGGACTCGAGTTTGTCCTCGACGTGGCTGTC
ATGGATGTCACCACCTGTAAAGTGCTTCCCAACACAATGGTTGAACTCTGGTCCCCTAACGCGATGGGTCAATAC
GGAAACTTCCTCCGAGGCGGCACTACCACATCATCGGGCGGTATTGCTGAATTCAGGACCATATACCCTGGAATG
TCAAAGGGTGCCAACCACGTTAACATTGCAGTCCACACCTCTTCCAGCATGTCTTCTTCCACCACTCACGTTGGA
AAACTTTTCTTCGTGGACAGGTGGAATGAGCTTATCCTTGGTACATCCCCATACACCCAAAATTCTAACCCCAAG
GTTTTGGACAATCAAGACGCTGACTACAGGAATGCTGTGAGCAAAGGATATTCCCCCGTTATCTCCATTACTTCT
ATCCATGATGACTGGCCAGAGGGTGTTGTCGGGATCGTCACTGTCGGTGTTAACCCTCACTAA
Transcript >AgabiH97|022370
ATGTACTCCAGTTTCTTCACTCTCATCCTCGCCGTCGCTGGCTCGGTTGTTAATGCCCTCCCAACGGCTGATGCC
CCAGCGCTGGTTCCGCGTGATTGCTCTGCTGAAGTAGCTGCGCTCAACATGAAGCGCGCTGAGAAACGTGGTCTC
GATGCACGTTCAGTCTGGCCCGGTCCTCAGAACACGACATGCGTTCTTGCCCCCGAATCACCCAAAGAAAATTAC
GTCGCTGGAATGCCTGCCAGATCCGACATTGCCGGCGGACAAGATGGACTCGAGTTTGTCCTCGACGTGGCTGTC
ATGGATGTCACCACCTGTAAAGTGCTTCCCAACACAATGGTTGAACTCTGGTCCCCTAACGCGATGGGTCAATAC
GGAAACTTCCTCCGAGGCGGCACTACCACATCATCGGGCGGTATTGCTGAATTCAGGACCATATACCCTGGAATG
TCAAAGGGTGCCAACCACGTTAACATTGCAGTCCACACCTCTTCCAGCATGTCTTCTTCCACCACTCACGTTGGA
AAACTTTTCTTCGTGGACAGGTGGAATGAGCTTATCCTTGGTACATCCCCATACACCCAAAATTCTAACCCCAAG
GTTTTGGACAATCAAGACGCTGACTACAGGAATGCTGTGAGCAAAGGATATTCCCCCGTTATCTCCATTACTTCT
ATCCATGATGACTGGCCAGAGGGTGTTGTCGGGATCGTCACTGTCGGTGTTAACCCTCACTAA
Gene >AgabiH97|022370
ATGTACTCCAGTTTCTTCACTCTCATCCTCGCCGTCGCTGGCTCGGTTGTTAATGGCAAGTGCCTCGACATTACG
CTCCACGAAGACTAATTGAACGGACTTGCCAGCCCTCCCAACGGCTGATGCCCCAGCGCTGGTTCCGCGTGATTG
CTCTGCTGAAGTAGCTGCGCTCAACATGAAGCGCGCTGAGAAACGTGGTCTCGATGCACGTTCAGTCTGGCCCGG
TCCTCAGAACGTAAGTCAGACGGCCATAGATATATACGTCTTTCATTGGTCTAACTGTAAACCACAGACGACATG
CGTTCTTGCCCCCGAATCACCCAAAGGTACTTTCGCTCAACCGCTACTCCGTAATCAATGCCTCACTGACATTGT
GATCCTAGAAAATTACGTCGCTGGAATGGTAAGGGCATTGTCTCACCGGCAATAATTTATTTTGTACTAACTGCT
TCATAAGCCTGCCAGATCCGACATTGCCGGCGGACAAGAGTACGTTCCGGTGCTCACAATATATTCCATTGCTTA
AGTTCTTAATCTTCTTGTTTTTATACACAGTGGACTCGAGTTTGTCCTCGACGTGGCTGTCATGGATGTCACCAC
CTGTAAAGTGCTTCCCAACACAATGGTTGAACTCTGGTCCCGTAAGTGAGCGTTTACAAGGATGAGTGGATTATA
CTGATTGATCGCTCAGCTAACGCGATGGGTCAATACGGAAACTTCCTCCGAGGCGGCACTACCACATCATCGGGC
GGTATTGCTGAATTCAGGACCATATACCCTGGAATGTCAAAGGGTGCCAACCACGTTAACATTGCAGTCCACACC
TCTTCCAGCATGTCTTCTTCCACCACTCACGTTGGAAAACTTTTCTTCGTGGACAGGTGGAATGAGCTTATCCTT
GGTACATCCCCATACACCCAAAATTCTAACCCCAAGGTTTTGGACAATCAAGACGCTGACTACAGGAATGCTGTG
AGCAAAGGATATTCCCCCGTTATCTCGTAAGCACTTTTTCTTCTAAAAAATTAGCTTTTTTCCCCCACTAAAACT
TCTCCAGCATTACTTCTATCCATGATGACTGGCCAGAGGGTGTTGTCGGGATCGTCAGTAAGTGTTGTTGTATCA
ATCCATAGATTGTGACTCAGTTAGACTTCCTCAGCTGTCGGTGTTAACCCTCACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail