Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|022330
Gene name
Locationscaffold_11:226810..228654
Strand-
Gene length (bp)1844
Transcript length (bp)1461
Coding sequence length (bp)1461
Protein length (aa) 487

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00092 VWA von Willebrand factor type A domain 4.1E-05 265 413

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 49 71 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|022330
MDCSPNTCFTQPPSTAPTSISTLLTSLPVPACGAVISLCMAAHHKLLISVITLSVVVGILLTLSLILLFFWCLRL
RHGREGPIPVEGGSVDTTESILERPKLSDRLGTGSNVTKVEEVAVLPSPLELGPPSSSKPQLDVRDAIQESHILP
LSRVSSATSVHAFSEDDQSQCPCAQSDMVSQCSEHQSTPAPSIGALSIDDFDQGQDDEFHPEVRALVESGKFTKD
AVRNMKPVAPKSGTVIPDYNPILDEVRPKKMDDYIRDYRIFFVIDDSGSMVPHWNETRDALSEIADYALNYHTDT
IDIRFFNSGYSRRGVRGMKEVMGAFRSVSPSNGTPTGPVLKEVLDQQLDRLNAAQSDGTYSSERPLDIIVLTDGV
PNQGPPPATVIEEAAKRFKAAGHHQNWVGIQFVQIGDDENAGPTLLSLIDCANNNHMVDTISYSLYKEQGGGKLT
PQILKRIILGALHPNLRSYWNQFRHKVNERTSQVIY*
Coding >AgabiH97|022330
ATGGACTGTTCACCCAACACCTGCTTTACGCAGCCACCTTCAACTGCCCCCACGTCAATTAGTACTCTTCTAACC
AGCTTACCTGTTCCCGCTTGCGGAGCAGTCATTTCGTTGTGTATGGCTGCCCATCATAAACTGCTTATTTCCGTG
ATCACTCTCAGCGTTGTAGTGGGAATCCTCTTAACTCTGTCTTTGATTCTCCTGTTTTTTTGGTGTCTTAGGCTT
CGGCATGGCAGGGAGGGACCTATTCCGGTCGAGGGCGGTTCAGTTGATACTACCGAGTCGATCCTTGAACGACCT
AAACTGTCTGACCGACTCGGTACTGGCAGTAATGTAACCAAAGTTGAAGAGGTTGCTGTACTGCCTTCTCCACTG
GAATTAGGGCCCCCTTCCTCGTCGAAGCCACAATTAGATGTACGAGACGCTATTCAAGAAAGTCACATTCTTCCT
CTTTCCAGAGTTTCGTCTGCTACCTCTGTACATGCATTTTCAGAAGACGATCAATCGCAATGTCCGTGCGCACAA
TCCGACATGGTTTCCCAGTGTTCGGAGCACCAATCTACCCCAGCCCCCTCCATCGGCGCTCTCTCTATTGACGAT
TTCGATCAAGGACAGGATGATGAATTCCATCCTGAAGTACGCGCACTTGTGGAGTCAGGGAAGTTTACAAAGGAT
GCCGTTCGAAATATGAAGCCCGTCGCGCCCAAGTCTGGTACTGTCATACCCGACTATAATCCCATCCTAGACGAA
GTAAGGCCAAAAAAAATGGATGATTATATCCGTGATTATCGAATTTTCTTCGTCATAGACGATTCGGGATCCATG
GTGCCGCATTGGAATGAAACACGGGACGCTCTTTCAGAGATTGCCGATTATGCCCTCAATTATCACACAGACACG
ATTGATATTCGTTTCTTTAATTCGGGATATTCAAGGCGCGGAGTTCGAGGTATGAAAGAAGTGATGGGCGCGTTC
CGTTCTGTCTCGCCATCTAACGGAACCCCAACTGGTCCAGTACTCAAAGAAGTACTTGATCAACAACTCGATCGT
CTCAATGCTGCCCAAAGCGACGGGACATATTCTTCAGAACGTCCCCTGGACATCATTGTCCTTACAGACGGCGTG
CCGAACCAGGGCCCTCCTCCTGCCACAGTCATAGAAGAAGCTGCCAAGCGATTCAAGGCTGCAGGGCATCACCAA
AATTGGGTTGGCATCCAGTTTGTACAAATCGGGGACGACGAAAACGCGGGCCCGACCCTCTTGTCCCTAATCGAC
TGCGCAAACAATAATCATATGGTTGATACCATCAGTTATAGTTTGTACAAAGAGCAGGGAGGCGGAAAATTGACT
CCTCAGATCTTGAAACGCATTATTTTGGGCGCGTTGCATCCTAATTTGCGCTCGTACTGGAACCAATTCCGCCAT
AAGGTGAATGAGAGAACGTCTCAGGTGATTTATTGA
Transcript >AgabiH97|022330
ATGGACTGTTCACCCAACACCTGCTTTACGCAGCCACCTTCAACTGCCCCCACGTCAATTAGTACTCTTCTAACC
AGCTTACCTGTTCCCGCTTGCGGAGCAGTCATTTCGTTGTGTATGGCTGCCCATCATAAACTGCTTATTTCCGTG
ATCACTCTCAGCGTTGTAGTGGGAATCCTCTTAACTCTGTCTTTGATTCTCCTGTTTTTTTGGTGTCTTAGGCTT
CGGCATGGCAGGGAGGGACCTATTCCGGTCGAGGGCGGTTCAGTTGATACTACCGAGTCGATCCTTGAACGACCT
AAACTGTCTGACCGACTCGGTACTGGCAGTAATGTAACCAAAGTTGAAGAGGTTGCTGTACTGCCTTCTCCACTG
GAATTAGGGCCCCCTTCCTCGTCGAAGCCACAATTAGATGTACGAGACGCTATTCAAGAAAGTCACATTCTTCCT
CTTTCCAGAGTTTCGTCTGCTACCTCTGTACATGCATTTTCAGAAGACGATCAATCGCAATGTCCGTGCGCACAA
TCCGACATGGTTTCCCAGTGTTCGGAGCACCAATCTACCCCAGCCCCCTCCATCGGCGCTCTCTCTATTGACGAT
TTCGATCAAGGACAGGATGATGAATTCCATCCTGAAGTACGCGCACTTGTGGAGTCAGGGAAGTTTACAAAGGAT
GCCGTTCGAAATATGAAGCCCGTCGCGCCCAAGTCTGGTACTGTCATACCCGACTATAATCCCATCCTAGACGAA
GTAAGGCCAAAAAAAATGGATGATTATATCCGTGATTATCGAATTTTCTTCGTCATAGACGATTCGGGATCCATG
GTGCCGCATTGGAATGAAACACGGGACGCTCTTTCAGAGATTGCCGATTATGCCCTCAATTATCACACAGACACG
ATTGATATTCGTTTCTTTAATTCGGGATATTCAAGGCGCGGAGTTCGAGGTATGAAAGAAGTGATGGGCGCGTTC
CGTTCTGTCTCGCCATCTAACGGAACCCCAACTGGTCCAGTACTCAAAGAAGTACTTGATCAACAACTCGATCGT
CTCAATGCTGCCCAAAGCGACGGGACATATTCTTCAGAACGTCCCCTGGACATCATTGTCCTTACAGACGGCGTG
CCGAACCAGGGCCCTCCTCCTGCCACAGTCATAGAAGAAGCTGCCAAGCGATTCAAGGCTGCAGGGCATCACCAA
AATTGGGTTGGCATCCAGTTTGTACAAATCGGGGACGACGAAAACGCGGGCCCGACCCTCTTGTCCCTAATCGAC
TGCGCAAACAATAATCATATGGTTGATACCATCAGTTATAGTTTGTACAAAGAGCAGGGAGGCGGAAAATTGACT
CCTCAGATCTTGAAACGCATTATTTTGGGCGCGTTGCATCCTAATTTGCGCTCGTACTGGAACCAATTCCGCCAT
AAGGTGAATGAGAGAACGTCTCAGGTGATTTATTGA
Gene >AgabiH97|022330
ATGGACTGTTCACCCAACACCTGCTTTACGCAGTGAGTAGTTTCATCCAGTTTCTGATAGTCTCCTTAATTTGAC
GCCACGGGATGGCAGGCCACCTTCAACTGCCCCCACGTCAATTAGTACTCTTCTAACCAGCTTACCTGTTCCCGC
TTGCGGAGCAGTCATTTCGTTGTGTATGGCTGCCCATCATAAACTGCTTATTTCCGTGATCACTCTCAGCGTTGT
AGTGGGAATCCTCTTAACTCTGTCTTTGATTCTCCTGTTTTTTTGGTGTCTTAGGCTTCGGCATGGCAGGGAGGG
ACCTATTCCGGTCGAGGGCGGTTCAGTTGATACTACCGAGTCGATCCTTGAACGACCTAAACTGTCTGACCGACT
CGGTACTGGCAGTAATGTAACCAAAGTTGAAGAGGTTGCTGTACTGCCTTCTCCACTGGAATTAGGGCCCCCTTC
CTCGTCGAAGCCACAATTAGATGTACGAGACGCTATTCAAGAAAGTCACATTCTTCCTCTTTCCAGAGTTTCGTC
TGCTACCTCTGTACATGCATTTTCAGAAGACGATCAATCGCAATGTCCGTGCGCACAATCCGACATGGTTTCCCA
GTGTTCGGAGCACCAATCTACCCCAGCCCCCTCCATCGGCGCTCTCTCTATTGACGATTTCGATCAAGGACAGGA
TGATGAATTCCATCCTGAAGTACGCGCACTTGTGGAGTCAGGGAAGTTTACAAAGGATGCCGTTCGAAATATGAA
GCCCGTCGCGCCCAAGTCTGGTACTGTCATACCCGACTATAATCCCATCCTAGACGAAGTAAGGCCAAAAAAAAT
GGATGATTATATCCGGTGAGTGCTTATTCGACTAATGATCTTTCTAACGTTGACGAGTTTCACAGTGATTATCGA
ATTTTCTTCGTCATAGACGATTCGGGATCCGTAAGTCTGATATTGCATGGTCTGGTAAGCATTAATGAATATGTC
TCGTTGATTGCAGATGGTGCCGCATTGGAATGAAACACGGGACGCTCTTTCAGAGATTGCCGATTATGCCCTCAA
TTATCACACAGACACGATTGATATTCGTTTCTTTAATTCGGGATATTCAAGGCGCGGAGTTCGAGTACGATATTT
GTCTTCCGCTCGCAATCCAGAACATTGTTGTCCTTACTATATCAATGACAGGGTATGAAAGAAGTGATGGGCGCG
TTCCGTTCTGTCTCGCCATCTAGTGAGTCTTACATACATTATCAGTCTGGATAAAGCATAACGAGAAAAAGACGG
AACCCCAACTGGTCCAGTACTCAAAGAAGTACTTGATCAACAACTCGATCGTCTCAATGCTGCCCAAAGCGACGG
GACATATTCTTCAGAACGTCCCCTGGACATCATTGTCCTTACAGACGGCGTGCCGAGTGAGATCTTTCTGCTTTA
CCTCATTGTTCAGATTAATGATTTATCTTGATAGACCAGGGCCCTCCTCCTGCCACAGTCATAGAAGAAGCTGCC
AAGCGATTCAAGGCTGCAGGGCATCACCAAAATTGGGTTGGCATCCAGTTTGTACAAATCGGGGACGACGAAAAC
GCGGGCCCGACCCTCTTGTCCCTAATCGACTGCGCAAACAATAATGTGAGTTGATTTGTAAAAAGTAGAGCTTGA
CTAACCTTCTTTCTACTTGATAGCATATGGTTGATACCATCAGTTATAGTTTGTACAAAGAGCAGGGAGGCGGAA
AATTGACTCCTCAGATCTTGAAACGCATTATTTTGGGCGCGTTGCATCCTAATTTGCGCTCGTACTGGAACCAAT
TCCGCCATAAGGTGAATGAGAGAACGTCTCAGGTGATTTATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail