Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|022290
Gene name
Locationscaffold_11:216204..219026
Strand+
Gene length (bp)2822
Transcript length (bp)2178
Coding sequence length (bp)2178
Protein length (aa) 726

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13415 Kelch_3 Galactose oxidase, central domain 4.7E-05 94 139
PF13415 Kelch_3 Galactose oxidase, central domain 7.5E-07 145 197
PF13415 Kelch_3 Galactose oxidase, central domain 1.4E-04 202 251
PF13418 Kelch_4 Galactose oxidase, central domain 3.1E-04 77 123
PF13418 Kelch_4 Galactose oxidase, central domain 2.8E-06 190 244
PF13422 DUF4110 Domain of unknown function (DUF4110) 6.5E-19 630 698
PF13964 Kelch_6 Kelch motif 2.3E-06 191 236
PF01344 Kelch_1 Kelch motif 9.8E-05 190 235

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08979|KEL3_YEAST Kelch repeat-containing protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL3 PE=1 SV=1 41 507 1.0E-68
sp|Q5R8W1|KLDC4_PONAB Kelch domain-containing protein 4 OS=Pongo abelii GN=KLHDC4 PE=2 SV=1 18 514 7.0E-66
sp|Q8TBB5|KLDC4_HUMAN Kelch domain-containing protein 4 OS=Homo sapiens GN=KLHDC4 PE=1 SV=1 18 549 1.0E-65
sp|Q921I2|KLDC4_MOUSE Kelch domain-containing protein 4 OS=Mus musculus GN=Klhdc4 PE=2 SV=2 18 514 5.0E-64
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 84 303 3.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08979|KEL3_YEAST Kelch repeat-containing protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL3 PE=1 SV=1 41 507 1.0E-68
sp|Q5R8W1|KLDC4_PONAB Kelch domain-containing protein 4 OS=Pongo abelii GN=KLHDC4 PE=2 SV=1 18 514 7.0E-66
sp|Q8TBB5|KLDC4_HUMAN Kelch domain-containing protein 4 OS=Homo sapiens GN=KLHDC4 PE=1 SV=1 18 549 1.0E-65
sp|Q921I2|KLDC4_MOUSE Kelch domain-containing protein 4 OS=Mus musculus GN=Klhdc4 PE=2 SV=2 18 514 5.0E-64
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 84 303 3.0E-11
sp|O14248|TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea3 PE=1 SV=1 109 261 9.0E-11
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 59 258 1.0E-09
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 90 253 2.0E-09
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 130 242 3.0E-09
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 83 289 4.0E-08
sp|Q5RDA9|FBX42_PONAB F-box only protein 42 OS=Pongo abelii GN=FBXO42 PE=2 SV=1 108 288 4.0E-07
sp|Q6P3S6|FBX42_HUMAN F-box only protein 42 OS=Homo sapiens GN=FBXO42 PE=1 SV=1 108 288 4.0E-07
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 77 264 5.0E-07
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 7 264 4.0E-06
sp|P80197|AFK_PHYPO Actin-fragmin kinase OS=Physarum polycephalum PE=1 SV=2 117 264 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|022290
MPKKKSNNAAAKAAKKVKAAQKIERKETKKVKKSKNKYHSEDEEEQDLEAVLEAMRKEWEDSHTVTEELVEGPPS
RRASATLTPCPNGSHLWCIGGEYFSEDGRAYFYNDVFRYTPEKDEWRKFVSPTCPGPRSAHAVTSSPVGGGKLFL
FGGEFSSLHQTTFHHYRDFWCFDIGTHSWDRIDTKIRPSARSGHRMTTWKQYIILFGGFYDPGITTRYLNDLWIF
DTHEYRWTQVEFREVDPKPSPRSGFSFLSCAEGVVLHGGYCKEYAKGKRPVGVMLEDTWLLRITIPTEQGATATP
SKPSKNKASQPQLVFKWERKKRASDAYAPSLRSGCTMALWNRSSGAGPTGILFGGVTDEDVHEETLESVFHNDLY
GYQLNGKGKWISMVLKKPKAKGGKKVTRAGKKKEAVKETMRGDQESEGDEDDEDDMSVKSPKALSAPKPSQSLVQ
AVNKDSDDPNLTIPMPRYNAMLAVLRNTLYIYGGILEKGSKEYTLDDFHLVQLDKLERYTCLKESAILIPDGEEE
SSSDEDDDEGDDEDDDEGDEEDDEPEEEPEQGNTEADIRLTEDGVDDELNGNARLKKNTEMTVFTDEVPTNNIQE
PTDEEVEDPDSLRSKANTFMGVSKDVSRSAEDVLSTPLPGETLAMFYARSREYWAQKAYGTSDNRGKELRRDGFA
RAEERYAEYKPILEEVEKILAEAGLDEEEMRRGAALGGGPAASGQSRNRR*
Coding >AgabiH97|022290
ATGCCAAAAAAGAAGAGCAACAATGCTGCCGCAAAAGCTGCAAAGAAAGTCAAGGCTGCACAAAAGATTGAAAGG
AAAGAGACCAAAAAAGTGAAAAAGTCCAAGAACAAGTATCATTCTGAAGATGAGGAAGAGCAAGATCTCGAGGCG
GTTTTGGAAGCGATGCGAAAAGAATGGGAAGACTCCCACACGGTCACTGAAGAACTGGTAGAAGGTCCACCTAGC
CGGCGCGCGAGTGCAACTCTTACTCCCTGCCCGAATGGAAGTCATCTATGGTGCATCGGCGGTGAATATTTCAGC
GAGGATGGAAGAGCCTACTTTTATAACGATGTCTTCAGATATACACCGGAGAAGGATGAATGGCGCAAATTCGTC
TCACCCACCTGTCCTGGTCCAAGGTCGGCACATGCCGTAACCTCATCTCCTGTAGGAGGGGGAAAGTTGTTTTTG
TTCGGCGGAGAATTCTCGTCGCTCCATCAGACCACATTCCATCACTATAGGGATTTCTGGTGTTTTGACATAGGA
ACGCACTCTTGGGATCGGATTGACACCAAGATCAGACCCAGTGCTCGATCTGGCCATCGAATGACAACCTGGAAA
CAATATATCATCTTATTCGGCGGGTTTTATGATCCGGGTATCACCACAAGATATCTGAATGATCTATGGATCTTC
GATACGCATGAATACAGGTGGACTCAAGTGGAGTTTCGTGAAGTGGACCCTAAACCATCACCTCGCAGCGGGTTT
TCATTCTTGTCATGCGCCGAAGGAGTTGTTTTACATGGTGGATACTGCAAAGAGTATGCGAAGGGAAAGCGTCCG
GTCGGAGTCATGCTTGAAGATACATGGCTACTAAGAATTACGATCCCTACTGAACAAGGAGCTACTGCTACCCCT
TCCAAGCCATCCAAAAACAAGGCCTCCCAACCACAACTCGTGTTCAAATGGGAACGTAAGAAACGTGCATCGGAT
GCTTACGCGCCGTCCCTTCGTTCTGGATGTACCATGGCCTTGTGGAATAGGAGCAGTGGTGCAGGACCGACAGGA
ATTTTATTCGGCGGTGTGACTGATGAGGATGTCCATGAGGAAACACTGGAGAGCGTATTCCACAACGACTTATAC
GGCTACCAACTTAACGGAAAAGGCAAATGGATCTCGATGGTGCTGAAGAAACCAAAAGCGAAGGGTGGAAAAAAG
GTGACGCGAGCAGGTAAGAAGAAAGAAGCTGTCAAAGAAACAATGCGGGGAGATCAAGAGAGCGAAGGTGACGAA
GATGATGAAGATGACATGTCGGTCAAGTCACCAAAGGCGCTAAGCGCCCCTAAACCCTCGCAATCGCTTGTACAG
GCCGTGAATAAAGATTCAGATGACCCTAATCTAACTATTCCTATGCCGCGTTATAATGCCATGCTCGCGGTGCTG
CGAAACACGCTGTATATATATGGCGGAATCCTTGAAAAGGGATCCAAGGAATACACGTTGGACGACTTCCACCTT
GTACAACTCGACAAATTGGAAAGATACACATGTTTGAAAGAAAGTGCGATCTTGATACCCGATGGTGAAGAAGAG
AGTAGCAGCGATGAGGATGATGACGAAGGCGATGACGAGGATGATGACGAGGGCGACGAGGAAGACGATGAACCT
GAGGAGGAACCAGAGCAAGGCAACACAGAAGCGGATATTAGATTGACTGAAGACGGCGTCGACGATGAGTTGAAT
GGAAATGCGAGATTGAAAAAGAATACAGAGATGACGGTTTTCACTGATGAAGTCCCTACTAATAATATCCAAGAA
CCGACGGATGAAGAGGTCGAAGATCCTGATTCATTACGTTCAAAAGCAAATACGTTCATGGGCGTATCCAAGGAC
GTCTCTCGCTCCGCTGAAGACGTGTTGAGTACCCCGCTTCCCGGGGAAACTCTCGCTATGTTTTATGCACGATCC
CGTGAATACTGGGCTCAGAAAGCGTACGGGACGAGCGACAACAGAGGAAAAGAACTTCGACGGGACGGCTTTGCC
AGGGCTGAAGAACGTTACGCCGAATACAAACCTATACTGGAAGAAGTTGAGAAGATTTTAGCAGAAGCGGGCTTG
GACGAGGAGGAGATGCGCAGAGGTGCTGCACTTGGTGGTGGCCCGGCTGCGAGTGGCCAGAGTCGCAACAGAAGA
TAA
Transcript >AgabiH97|022290
ATGCCAAAAAAGAAGAGCAACAATGCTGCCGCAAAAGCTGCAAAGAAAGTCAAGGCTGCACAAAAGATTGAAAGG
AAAGAGACCAAAAAAGTGAAAAAGTCCAAGAACAAGTATCATTCTGAAGATGAGGAAGAGCAAGATCTCGAGGCG
GTTTTGGAAGCGATGCGAAAAGAATGGGAAGACTCCCACACGGTCACTGAAGAACTGGTAGAAGGTCCACCTAGC
CGGCGCGCGAGTGCAACTCTTACTCCCTGCCCGAATGGAAGTCATCTATGGTGCATCGGCGGTGAATATTTCAGC
GAGGATGGAAGAGCCTACTTTTATAACGATGTCTTCAGATATACACCGGAGAAGGATGAATGGCGCAAATTCGTC
TCACCCACCTGTCCTGGTCCAAGGTCGGCACATGCCGTAACCTCATCTCCTGTAGGAGGGGGAAAGTTGTTTTTG
TTCGGCGGAGAATTCTCGTCGCTCCATCAGACCACATTCCATCACTATAGGGATTTCTGGTGTTTTGACATAGGA
ACGCACTCTTGGGATCGGATTGACACCAAGATCAGACCCAGTGCTCGATCTGGCCATCGAATGACAACCTGGAAA
CAATATATCATCTTATTCGGCGGGTTTTATGATCCGGGTATCACCACAAGATATCTGAATGATCTATGGATCTTC
GATACGCATGAATACAGGTGGACTCAAGTGGAGTTTCGTGAAGTGGACCCTAAACCATCACCTCGCAGCGGGTTT
TCATTCTTGTCATGCGCCGAAGGAGTTGTTTTACATGGTGGATACTGCAAAGAGTATGCGAAGGGAAAGCGTCCG
GTCGGAGTCATGCTTGAAGATACATGGCTACTAAGAATTACGATCCCTACTGAACAAGGAGCTACTGCTACCCCT
TCCAAGCCATCCAAAAACAAGGCCTCCCAACCACAACTCGTGTTCAAATGGGAACGTAAGAAACGTGCATCGGAT
GCTTACGCGCCGTCCCTTCGTTCTGGATGTACCATGGCCTTGTGGAATAGGAGCAGTGGTGCAGGACCGACAGGA
ATTTTATTCGGCGGTGTGACTGATGAGGATGTCCATGAGGAAACACTGGAGAGCGTATTCCACAACGACTTATAC
GGCTACCAACTTAACGGAAAAGGCAAATGGATCTCGATGGTGCTGAAGAAACCAAAAGCGAAGGGTGGAAAAAAG
GTGACGCGAGCAGGTAAGAAGAAAGAAGCTGTCAAAGAAACAATGCGGGGAGATCAAGAGAGCGAAGGTGACGAA
GATGATGAAGATGACATGTCGGTCAAGTCACCAAAGGCGCTAAGCGCCCCTAAACCCTCGCAATCGCTTGTACAG
GCCGTGAATAAAGATTCAGATGACCCTAATCTAACTATTCCTATGCCGCGTTATAATGCCATGCTCGCGGTGCTG
CGAAACACGCTGTATATATATGGCGGAATCCTTGAAAAGGGATCCAAGGAATACACGTTGGACGACTTCCACCTT
GTACAACTCGACAAATTGGAAAGATACACATGTTTGAAAGAAAGTGCGATCTTGATACCCGATGGTGAAGAAGAG
AGTAGCAGCGATGAGGATGATGACGAAGGCGATGACGAGGATGATGACGAGGGCGACGAGGAAGACGATGAACCT
GAGGAGGAACCAGAGCAAGGCAACACAGAAGCGGATATTAGATTGACTGAAGACGGCGTCGACGATGAGTTGAAT
GGAAATGCGAGATTGAAAAAGAATACAGAGATGACGGTTTTCACTGATGAAGTCCCTACTAATAATATCCAAGAA
CCGACGGATGAAGAGGTCGAAGATCCTGATTCATTACGTTCAAAAGCAAATACGTTCATGGGCGTATCCAAGGAC
GTCTCTCGCTCCGCTGAAGACGTGTTGAGTACCCCGCTTCCCGGGGAAACTCTCGCTATGTTTTATGCACGATCC
CGTGAATACTGGGCTCAGAAAGCGTACGGGACGAGCGACAACAGAGGAAAAGAACTTCGACGGGACGGCTTTGCC
AGGGCTGAAGAACGTTACGCCGAATACAAACCTATACTGGAAGAAGTTGAGAAGATTTTAGCAGAAGCGGGCTTG
GACGAGGAGGAGATGCGCAGAGGTGCTGCACTTGGTGGTGGCCCGGCTGCGAGTGGCCAGAGTCGCAACAGAAGA
TAA
Gene >AgabiH97|022290
ATGCCAAAAAAGAAGAGCAACAATGCTGCCGCAAAAGCTGCAAAGAAAGTCAAGGCTGCACAAAAGATTGAAAGG
AAAGAGACCAAAAAAGTGAAAAAGTCCAAGAACAAGTATCATTCTGAAGATGAGGAAGAGCAAGATCTCGAGGCG
GTTTTGGAAGCGGTATATTCACATCTGTTTTACATTTGTGCTCTAATCTTGACTGACGTTGTTCACCGTAGTAGA
TGCGAAAAGAATGGGAAGACTCCCACACGGTCACTGAAGAACTGGTAGAAGGTCCACCTAGCCGGCGCGCGAGTG
CAACTCTTACTCCCTGCCCGAATGGAAGTCATCTATGGTGCATCGGCGGTGAATATTTCAGCGAGGATGGAAGAG
CCGTACGTATCCAAAGGGTTGTACTGCAATACCAGAACTTATGAGCGTACGCAGTACTTTTATAACGATGTCTTC
AGATATACACCGGAGAAGGATGAATGGCGCAAATTCGTCTCACCCACCTGTCCTGGTCCAAGGTCGGCACATGCC
GTAACCTCATCTCCTGTAGGAGGGGGAAAGTTGTTTTTGTTCGGTATATGGCGGTAGATCTTTACCTCTCAATGC
CTTAATTGACTCGACGATCGGCAGGCGGAGAATTCTCGTCGCTCCATCAGACCACATTCCATCACTATAGGGATT
TCTGGTGTTTTGACATAGGAACGCACTCTTGGGATCGGATTGACACCAAGATCAGACCCAGTGCTCGATCTGGCC
ATCGGTGAGCTTCATTATAGCGGCCTCACCATTCGTCAAGACTTAATTGTTGTAGAATGACAACCTGGAAACAAT
ATATCATCTTATTCGGCGGGTTTTATGATCCGGGTATCACCAGTAAGCCTTCCCTCATGATGTATTCATTCCTCC
TTGATCACCTCTCAAATTAGCAAGATATCTGAATGATCTATGGATCTTCGATACGCATGAATACAGGTGGACTCA
AGTGGAGTTTCGTGAAGTGGACCCTAAACCATCGTAAGCTGATTGTGCACCCCAAAGTCACCAATCGTTAACCAT
ACAACAGACCTCGCAGCGGGTTTTCATTCTTGTCATGCGCCGAAGGAGTTGTTTTACATGGTGGATACTGCAAAG
AGTATGCGAAGGGAAAGCGTCCGGTCGGAGTCATGCTTGAAGATACATGGCTACTAAGGTCCGTCTCATATGTTT
TAACTCTTCTTCGTAACGAATCGGCTTCACCGTGCTCCAGAATTACGATCCCTACTGAACAAGGAGCTACTGCTA
CCCCTTCCAAGCCATCCAAAAACAAGGCCTCCCAACCACAACTCGTGTTCAAATGGGAACGTAAGAAACGTGCAT
CGGATGCTTACGCGCCGTCCCTTCGTTCTGGATGTACCATGGCCTTGTGGAATAGGAGCAGTGGTGCAGGACCGA
CAGGAATTTTATTCGGCGGTGTGACTGATGAGGATGTCCATGAGGAAACACTGGAGAGCGTATTCCACAACGACT
TGTCTGTATCATTCTCTCCTAGATCAGTATTTGTCATTGATTCTTTATAGATACGGCTACCAACTTAACGGAAAA
GGCAAATGGATCTCGATGGTGCTGAAGAAACCAAAAGCGAAGGGTGGAAAAAAGGTGACGCGAGCAGGTAAGAAG
AAAGAAGCTGTCAAAGAAACAATGCGGGGAGATCAAGAGAGCGAAGGTGACGAAGATGATGAAGATGACATGTCG
GTCAAGTCACCAAAGGCGCTAAGCGCCCCTAAACCCTCGCAATCGCTTGTACAGGCCGTGAATAAAGATTCAGAT
GACCCTAATCTAACTATTCCTATGCCGCGTTATAATGCCATGCTCGCGGTGCTGCGAAACACGCTGTATATGTGA
GTCCTTTCGATCGTCGTCGTCCAATCGGATGCATTGAACCCATTGTAGATATGGCGGAATCCTTGAAAAGGGATC
CAAGGAATACACGTTGGACGACTTCCACCTTGTACAACTCGACAAATTGGAAAGATACACATGTTTGAAAGAAAG
TGCGATCTTGATACCCGATGGTGAAGAAGAGAGTAGCAGCGATGAGGATGATGACGAAGGCGATGACGAGGATGA
TGACGAGGGCGACGAGGAAGACGATGAACCTGAGGAGGAACCAGAGCAAGGCAACACAGAAGCGGATATTAGATT
GACTGAAGACGGCGTCGACGATGAGTTGAATGGAAATGCGAGATTGAAAAAGAATACAGAGATGACGGTTTTCAC
TGATGAAGTCCCTACTAATAATATCCAAGAACCGACGGATGAAGAGGTCGAAGATCCTGTACGTCAGAGCATGTC
TAATCAAGCCTTCCACTAACGTATCTTAGGATTCATTACGTTCAAAAGCAAATACGTTCATGGGCGTATCCAAGG
ACGTCTCTCGCTCCGCTGAAGACGTGTTGAGTACCCCGCTTCCCGGGGAAACTCTCGCTATGTTTTATGCACGAT
CCCGTATGCTTACTCAAACATATCAAATACTCTTGATTATGGCTCATTTCAAGAACACAGGTGAATACTGGGCTC
AGAAAGCGTACGGGACGAGCGACAACAGAGGAAAAGAACTTCGACGGGACGGCTTTGCCAGGGCTGAAGAACGTT
ACGGTAAGATTACCCTCTAGGTTGTGATATAGTAATTATGATGCCGGTCTTTGATGCTTCTAGCCGAATACAAAC
CTATACTGGAAGAAGTTGAGAAGATTTTAGCAGAAGCGGGCTTGGACGAGGAGGAGATGCGCAGAGGTGCTGCAC
TTGGTGGTGGCCCGGCTGCGAGTGGCCAGAGTCGCAACAGAAGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail