Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|022180
Gene name
Locationscaffold_11:173189..174997
Strand+
Gene length (bp)1808
Transcript length (bp)1347
Coding sequence length (bp)1347
Protein length (aa) 449

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00128 Alpha-amylase Alpha amylase, catalytic domain 1.8E-13 90 312
PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain 3.1E-08 391 438

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P27350|AMY_STRTL Alpha-amylase OS=Streptomyces thermoviolaceus GN=amy PE=3 SV=2 25 434 3.0E-131
sp|P08486|AMY_STRHY Alpha-amylase OS=Streptomyces hygroscopicus PE=3 SV=1 31 446 5.0E-125
sp|P29750|AMY_THECU Alpha-amylase OS=Thermomonospora curvata GN=tam PE=1 SV=1 33 448 3.0E-123
sp|P22998|AMY_STRVL Alpha-amylase OS=Streptomyces violaceus GN=aml PE=2 SV=1 31 434 4.0E-123
sp|P09794|AMY_STRLM Alpha-amylase OS=Streptomyces limosus GN=aml PE=3 SV=1 35 437 2.0E-122
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P27350|AMY_STRTL Alpha-amylase OS=Streptomyces thermoviolaceus GN=amy PE=3 SV=2 25 434 3.0E-131
sp|P08486|AMY_STRHY Alpha-amylase OS=Streptomyces hygroscopicus PE=3 SV=1 31 446 5.0E-125
sp|P29750|AMY_THECU Alpha-amylase OS=Thermomonospora curvata GN=tam PE=1 SV=1 33 448 3.0E-123
sp|P22998|AMY_STRVL Alpha-amylase OS=Streptomyces violaceus GN=aml PE=2 SV=1 31 434 4.0E-123
sp|P09794|AMY_STRLM Alpha-amylase OS=Streptomyces limosus GN=aml PE=3 SV=1 35 437 2.0E-122
sp|P30270|AMY_STRGR Alpha-amylase OS=Streptomyces griseus GN=amy PE=3 SV=1 35 437 2.0E-121
sp|P56634|AMY_TENMO Alpha-amylase OS=Tenebrio molitor PE=1 SV=1 35 448 6.0E-109
sp|P29957|AMY_PSEHA Alpha-amylase OS=Pseudoalteromonas haloplanktis GN=amy PE=1 SV=3 37 446 5.0E-108
sp|O18552|AMYR_DROPS Alpha-amylase-related protein OS=Drosophila pseudoobscura pseudoobscura GN=Amyrel PE=3 SV=2 33 448 4.0E-106
sp|Q9NJN7|AMYR_DROVA Alpha-amylase-related protein OS=Drosophila varians GN=Amyrel PE=3 SV=1 21 448 5.0E-106
sp|O18344|AMYR_DROAN Alpha-amylase-related protein OS=Drosophila ananassae GN=Amyrel PE=3 SV=2 12 448 1.0E-105
sp|Q9NJN8|AMYR_DROBP Alpha-amylase-related protein OS=Drosophila bipectinata GN=Amyrel PE=3 SV=1 21 448 2.0E-104
sp|O77013|AMYR_DROKI Alpha-amylase-related protein OS=Drosophila kikkawai GN=Amyrel PE=3 SV=2 33 448 4.0E-104
sp|O76262|AMYR_DROLN Alpha-amylase-related protein OS=Drosophila lini GN=Amyrel PE=3 SV=2 33 448 1.0E-103
sp|Q23835|AMY1_DROAN Alpha-amylase 1 OS=Drosophila ananassae GN=Amy35 PE=3 SV=3 7 448 1.0E-103
sp|O18345|AMY2_DROAN Alpha-amylase 2 OS=Drosophila ananassae GN=Amy58 PE=3 SV=2 7 448 2.0E-103
sp|P08144|AMYA_DROME Alpha-amylase A OS=Drosophila melanogaster GN=Amy-p PE=2 SV=1 7 448 4.0E-103
sp|P81641|AMYB_DROME Alpha-amylase B OS=Drosophila melanogaster GN=Amy-d PE=3 SV=3 7 448 4.0E-103
sp|P54215|AMYA_DROMA Alpha-amylase A OS=Drosophila mauritiana GN=Amy-d PE=3 SV=1 7 448 8.0E-103
sp|O77019|AMYR_DROBA Alpha-amylase-related protein OS=Drosophila bakoue GN=Amyrel PE=3 SV=2 33 448 9.0E-103
sp|Q9GQV3|AMYR_DROJA Alpha-amylase-related protein OS=Drosophila jambulina GN=Amyrel PE=3 SV=1 33 448 1.0E-102
sp|O76284|AMYR_DROBC Alpha-amylase-related protein OS=Drosophila bocqueti GN=Amyrel PE=3 SV=2 33 448 1.0E-102
sp|O77011|AMYR_DROAP Alpha-amylase-related protein OS=Drosophila atripex GN=Amyrel PE=3 SV=3 21 448 3.0E-102
sp|O77012|AMYR_DROEC Alpha-amylase-related protein OS=Drosophila ercepeae GN=Amyrel PE=3 SV=2 33 448 6.0E-102
sp|Q9BN01|AMYB_DROYA Alpha-amylase B OS=Drosophila yakuba GN=Amy-d PE=3 SV=2 7 448 6.0E-102
sp|O77021|AMYR_DRODO Alpha-amylase-related protein OS=Drosophila dossoui GN=Amyrel PE=3 SV=2 33 448 7.0E-102
sp|O77020|AMYR_DROAV Alpha-amylase-related protein OS=Drosophila auraria GN=Amyrel PE=3 SV=2 33 448 7.0E-102
sp|O18420|AMYR_DROSU Alpha-amylase-related protein OS=Drosophila subobscura GN=Amyrel PE=3 SV=1 33 448 8.0E-102
sp|P83833|AMYA_DROYA Alpha-amylase A OS=Drosophila yakuba GN=Amy-p PE=3 SV=1 7 448 2.0E-101
sp|O77018|AMYR_DROTK Alpha-amylase-related protein OS=Drosophila takahashii GN=Amyrel PE=3 SV=2 33 448 2.0E-101
sp|Q23834|AM4N_DROAN Alpha-amylase 4N OS=Drosophila ananassae GN=Amy4N PE=3 SV=2 23 448 3.0E-101
sp|O77022|AMYR_DROPN Alpha-amylase-related protein OS=Drosophila punjabiensis GN=Amyrel PE=3 SV=1 33 448 6.0E-101
sp|O18408|AMYR_DROME Alpha-amylase-related protein OS=Drosophila melanogaster GN=Amyrel PE=2 SV=2 33 448 9.0E-101
sp|O76459|AMYR_DROSR Alpha-amylase-related protein OS=Drosophila serrata GN=Amyrel PE=3 SV=1 33 448 1.0E-100
sp|O76261|AMYR_DROSE Alpha-amylase-related protein OS=Drosophila sechellia GN=Amyrel PE=3 SV=1 33 448 1.0E-100
sp|O77016|AMYR_DROSI Alpha-amylase-related protein OS=Drosophila simulans GN=Amyrel PE=3 SV=3 33 448 2.0E-100
sp|O77014|AMYR_DROMA Alpha-amylase-related protein OS=Drosophila mauritiana GN=Amyrel PE=3 SV=2 12 448 3.0E-100
sp|O77015|AMYR_DROOR Alpha-amylase-related protein OS=Drosophila orena GN=Amyrel PE=3 SV=2 33 448 4.0E-100
sp|O76260|AMYR_DROTE Alpha-amylase-related protein OS=Drosophila teissieri GN=Amyrel PE=3 SV=2 33 448 5.0E-100
sp|O76264|AMYR_DROYA Alpha-amylase-related protein OS=Drosophila yakuba GN=Amyrel PE=3 SV=2 33 448 1.0E-99
sp|Q9NJP0|AMYR_DROEL Alpha-amylase-related protein OS=Drosophila elegans GN=Amyrel PE=3 SV=2 33 448 3.0E-99
sp|P19961|AMY2B_HUMAN Alpha-amylase 2B OS=Homo sapiens GN=AMY2B PE=1 SV=1 38 446 3.0E-98
sp|O76265|AMYR_DROER Alpha-amylase-related protein OS=Drosophila erecta GN=Amyrel PE=3 SV=2 33 448 4.0E-98
sp|O76263|AMYR_DROWI Alpha-amylase-related protein OS=Drosophila willistoni GN=Amyrel PE=3 SV=1 33 448 4.0E-98
sp|P04746|AMYP_HUMAN Pancreatic alpha-amylase OS=Homo sapiens GN=AMY2A PE=1 SV=2 38 446 1.0E-97
sp|P00690|AMYP_PIG Pancreatic alpha-amylase OS=Sus scrofa GN=AMY2 PE=1 SV=3 9 446 4.0E-97
sp|P04745|AMY1_HUMAN Alpha-amylase 1 OS=Homo sapiens GN=AMY1A PE=1 SV=2 38 446 2.0E-96
sp|P09107|AMY_TRICA Alpha-amylase (Fragment) OS=Tribolium castaneum PE=3 SV=2 32 448 1.0E-95
sp|P00687|AMY1_MOUSE Alpha-amylase 1 OS=Mus musculus GN=Amy1 PE=1 SV=2 35 446 1.0E-94
sp|P00689|AMYP_RAT Pancreatic alpha-amylase OS=Rattus norvegicus GN=Amy2 PE=2 SV=2 35 446 1.0E-94
sp|O97396|AMY_PHACE Alpha-amylase OS=Phaedon cochleariae PE=2 SV=1 35 448 3.0E-94
sp|P00688|AMYP_MOUSE Pancreatic alpha-amylase OS=Mus musculus GN=Amy2 PE=1 SV=2 32 446 6.0E-94
sp|P91778|AMY_PECMA Alpha-amylase OS=Pecten maximus PE=2 SV=1 8 446 2.0E-93
sp|P83053|AMYP_STRCA Pancreatic alpha-amylase OS=Struthio camelus PE=1 SV=1 38 446 3.0E-93
sp|P53354|AMY1_AEDAE Alpha-amylase I OS=Aedes aegypti GN=AMY1 PE=2 SV=2 38 446 7.0E-83
sp|P41131|AMYA_AERHY Alpha-amylase OS=Aeromonas hydrophila GN=amyA PE=3 SV=1 35 430 6.0E-69
sp|P23671|AMY_CLOAB Alpha-amylase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=amyA PE=3 SV=2 27 300 2.0E-19
sp|P22630|AMY1_AERHY Alpha-amylase OS=Aeromonas hydrophila PE=3 SV=1 30 413 1.0E-18
sp|P00691|AMY_BACSU Alpha-amylase OS=Bacillus subtilis (strain 168) GN=amyE PE=1 SV=2 8 431 3.0E-18
sp|P19531|AMYM_GEOSE Maltogenic alpha-amylase OS=Geobacillus stearothermophilus GN=amyM PE=1 SV=2 79 445 2.0E-16
sp|P14014|CDGT_BACLI Cyclomaltodextrin glucanotransferase OS=Bacillus licheniformis GN=cgtA PE=3 SV=1 95 439 1.0E-11
sp|P21543|AMYB_PAEPO Beta/alpha-amylase OS=Paenibacillus polymyxa PE=1 SV=1 88 303 3.0E-11
sp|P26827|CDGT_THETU Cyclomaltodextrin glucanotransferase OS=Thermoanaerobacterium thermosulfurigenes GN=amyA PE=1 SV=2 95 445 4.0E-11
sp|P30920|CDGT1_BACCI Cyclomaltodextrin glucanotransferase OS=Bacillus circulans PE=1 SV=1 95 439 9.0E-11
sp|P0C1B4|AMYA3_ASPOR Alpha-amylase A type-3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=amy3 PE=3 SV=1 55 216 2.0E-10
sp|P30292|AMY_ASPSH Alpha-amylase OS=Aspergillus shirousami GN=amy PE=1 SV=1 55 216 2.0E-10
sp|Q02905|AMYA_ASPAW Alpha-amylase A OS=Aspergillus awamori GN=amyA PE=3 SV=1 55 216 2.0E-10
sp|P0C1B3|AMYA1_ASPOR Alpha-amylase A type-1/2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=amy1 PE=1 SV=1 55 216 2.0E-10
sp|Q02906|AMYB_ASPAW Alpha-amylase B OS=Aspergillus awamori GN=amyB PE=3 SV=1 55 216 2.0E-10
sp|P43379|CDGT2_BACCI Cyclomaltodextrin glucanotransferase OS=Bacillus circulans GN=cgt PE=1 SV=1 95 445 3.0E-10
sp|P08137|AMY_BACCI Alpha-amylase OS=Bacillus circulans PE=3 SV=1 95 440 3.0E-10
sp|P09121|CDGT_BACS3 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 38-2) GN=cgt PE=1 SV=2 95 440 5.0E-10
sp|P30269|AMY_BUTFI Alpha-amylase OS=Butyrivibrio fibrisolvens GN=amyA PE=3 SV=1 37 220 3.0E-09
sp|P30921|CDGT_BAC11 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 17-1) GN=cgt PE=1 SV=1 95 434 3.0E-09
sp|P05618|CDGT_BACS0 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 1011) GN=cgt PE=1 SV=1 95 440 4.0E-09
sp|P27036|CDGT_BACOH Cyclomaltodextrin glucanotransferase OS=Bacillus ohbensis GN=cgt PE=3 SV=2 95 436 1.0E-08
sp|P04830|CDGT1_PAEMA Cyclomaltodextrin glucanotransferase OS=Paenibacillus macerans GN=cgtM PE=1 SV=2 30 439 3.0E-08
sp|P19269|AMY1_SCHOC Alpha-amylase 1 OS=Schwanniomyces occidentalis GN=AMY1 PE=1 SV=1 90 223 4.0E-08
sp|A6V628|GLGB_PSEA7 1,4-alpha-glucan branching enzyme GlgB OS=Pseudomonas aeruginosa (strain PA7) GN=glgB PE=3 SV=1 45 226 1.0E-07
sp|Q9I1W2|GLGB_PSEAE 1,4-alpha-glucan branching enzyme GlgB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=glgB PE=3 SV=1 45 226 2.0E-07
sp|Q08806|AMY2_SCHOC Alpha-amylase 2 OS=Schwanniomyces occidentalis GN=SWA2 PE=3 SV=1 55 216 2.0E-07
sp|Q8PDD1|GLGB2_XANCP 1,4-alpha-glucan branching enzyme GlgB 2 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=glgB2 PE=3 SV=1 45 141 5.0E-07
sp|Q4UZL7|GLGB2_XANC8 1,4-alpha-glucan branching enzyme GlgB 2 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=glgB2 PE=3 SV=1 45 141 5.0E-07
sp|P56271|AMYA_ASPNG Acid alpha-amylase OS=Aspergillus niger PE=1 SV=1 55 216 6.0E-07
sp|Q7MG90|GLGB_VIBVY 1,4-alpha-glucan branching enzyme GlgB OS=Vibrio vulnificus (strain YJ016) GN=glgB PE=3 SV=2 45 129 6.0E-07
sp|Q8D4P0|GLGB_VIBVU 1,4-alpha-glucan branching enzyme GlgB OS=Vibrio vulnificus (strain CMCP6) GN=glgB PE=3 SV=1 45 129 6.0E-07
sp|Q88FN1|GLGB_PSEPK 1,4-alpha-glucan branching enzyme GlgB OS=Pseudomonas putida (strain KT2440) GN=glgB PE=3 SV=1 44 143 8.0E-07
sp|Q1AZ86|GLGB_RUBXD 1,4-alpha-glucan branching enzyme GlgB OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=glgB PE=3 SV=1 48 123 9.0E-07
sp|P31835|CDGT2_PAEMA Cyclomaltodextrin glucanotransferase OS=Paenibacillus macerans PE=1 SV=1 67 437 9.0E-07
sp|Q9Y7S9|AMY3_SCHPO Alpha-amylase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aah3 PE=1 SV=1 55 216 2.0E-06
sp|P31746|CDGT_BACS2 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 1-1) GN=cgt PE=1 SV=1 79 436 3.0E-06
sp|Q8PQA2|GLGB2_XANAC 1,4-alpha-glucan branching enzyme GlgB 2 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=glgB2 PE=3 SV=1 45 123 3.0E-06
sp|Q3BYI0|GLGB2_XANC5 1,4-alpha-glucan branching enzyme GlgB 2 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=glgB2 PE=3 SV=1 45 122 4.0E-06
sp|P14899|AMY3_DICT6 Alpha-amylase 3 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=amyC PE=3 SV=2 81 224 4.0E-06
sp|P31797|CDGT_GEOSE Cyclomaltodextrin glucanotransferase OS=Geobacillus stearothermophilus GN=cgt PE=1 SV=1 95 439 4.0E-06
sp|Q4KCQ3|GLGB_PSEF5 1,4-alpha-glucan branching enzyme GlgB OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=glgB PE=3 SV=1 43 227 6.0E-06
sp|Q87FR0|GLGB_VIBPA 1,4-alpha-glucan branching enzyme GlgB OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=glgB PE=3 SV=1 45 129 8.0E-06
sp|Q09840|AMY2_SCHPO Alpha-amylase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aah2 PE=1 SV=1 55 303 9.0E-06
sp|Q2P949|GLGB2_XANOM 1,4-alpha-glucan branching enzyme GlgB 2 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=glgB2 PE=3 SV=1 45 223 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0003824 catalytic activity Yes
GO:0043169 cation binding Yes
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|022180
MLKWSILFLSLFQTIQAAPFAFNATLDKRAPSGNKNVIIQLFEWNWDSVAAECRNFIGPHGYGFVQVSPPQEHIT
GSQWWTDYQPVSYTLTSKRGNRSQFQNMINACHSAGVGVIVDTIFNHMAGIDSGSGVGGSSFSHYNYPGIYQVQD
FHHCGFHPSDDIENFSNRQEVQTCELVNLADLATDTEYVRGRLAQYGNDLLSLGVDGMRLDAAKHISAGDLSNIL
GRLSRRPYISQEVIFGGGEPIQPSEYTGNGDVQEFRYTTTIRDAFSGGGISSLQNLDNRGWVAGNRANVFVANHD
TERNGGSLRYDSSSNTYITATIFSLAHPYGTPTIISSYNIPNNDAGAPNGGSGSCSTTGGANGWLCQHRFVAITG
MVGFRNNVGSATLNNWVSPQSQQIAFGRGSLGYVAINNGNSQWSSTFTTSLPDGTYCDVIRGTVSNGRCSGPS*
Coding >AgabiH97|022180
ATGTTGAAATGGTCTATATTGTTTCTTTCCCTCTTTCAAACAATTCAAGCCGCTCCATTTGCGTTTAATGCGACG
CTTGATAAACGCGCCCCTAGCGGAAATAAAAATGTGATCATACAATTGTTCGAATGGAACTGGGATTCTGTAGCT
GCTGAATGTCGAAACTTTATCGGACCTCATGGCTATGGTTTTGTTCAAGTGAGCCCGCCGCAGGAGCACATAACT
GGCTCTCAGTGGTGGACCGATTATCAACCCGTTTCGTACACGCTCACGTCGAAACGCGGAAACCGCTCCCAGTTC
CAGAACATGATAAACGCTTGTCATTCTGCTGGAGTAGGCGTCATAGTTGACACGATTTTCAATCACATGGCTGGT
ATCGACTCGGGCTCAGGCGTCGGAGGAAGTTCTTTCAGTCATTACAACTATCCCGGTATCTACCAGGTTCAAGAC
TTCCATCATTGCGGTTTCCACCCCAGTGATGATATCGAAAATTTCAGCAATCGACAGGAAGTTCAGACCTGTGAA
CTAGTCAATCTCGCTGACCTTGCGACAGACACCGAGTATGTTAGGGGACGACTCGCACAATATGGAAATGACTTG
TTATCGCTCGGAGTCGACGGAATGAGGTTGGATGCTGCTAAGCATATTTCTGCTGGAGATCTCTCGAATATCCTT
GGTAGATTATCCCGAAGGCCATATATCTCGCAGGAAGTCATTTTCGGTGGAGGGGAGCCTATACAACCTTCGGAG
TACACTGGAAACGGCGACGTACAAGAATTCAGATACACTACAACAATAAGGGACGCCTTTTCAGGGGGAGGCATT
TCAAGTCTTCAGAACCTGGATAATCGAGGTTGGGTCGCTGGCAACCGAGCGAATGTCTTTGTCGCGAATCATGAC
ACCGAACGCAATGGAGGCTCCCTAAGATATGATTCTTCTTCCAATACATATATCACGGCAACGATCTTTTCTCTT
GCACATCCATATGGAACTCCCACCATCATTTCGAGTTATAATATTCCCAACAATGACGCCGGCGCACCCAATGGC
GGCTCCGGATCTTGTAGCACAACTGGAGGAGCAAACGGCTGGCTTTGTCAACATCGTTTCGTTGCCATCACTGGA
ATGGTAGGATTCCGCAACAATGTAGGCTCAGCTACGTTAAATAACTGGGTGTCGCCACAATCTCAACAAATCGCC
TTTGGCCGTGGTTCACTTGGTTATGTGGCGATAAATAATGGAAATTCACAATGGAGCTCCACTTTTACTACGTCA
TTGCCAGACGGAACGTATTGTGATGTGATCAGGGGAACGGTCAGTAATGGAAGATGCTCAGGGCCTTCGTGA
Transcript >AgabiH97|022180
ATGTTGAAATGGTCTATATTGTTTCTTTCCCTCTTTCAAACAATTCAAGCCGCTCCATTTGCGTTTAATGCGACG
CTTGATAAACGCGCCCCTAGCGGAAATAAAAATGTGATCATACAATTGTTCGAATGGAACTGGGATTCTGTAGCT
GCTGAATGTCGAAACTTTATCGGACCTCATGGCTATGGTTTTGTTCAAGTGAGCCCGCCGCAGGAGCACATAACT
GGCTCTCAGTGGTGGACCGATTATCAACCCGTTTCGTACACGCTCACGTCGAAACGCGGAAACCGCTCCCAGTTC
CAGAACATGATAAACGCTTGTCATTCTGCTGGAGTAGGCGTCATAGTTGACACGATTTTCAATCACATGGCTGGT
ATCGACTCGGGCTCAGGCGTCGGAGGAAGTTCTTTCAGTCATTACAACTATCCCGGTATCTACCAGGTTCAAGAC
TTCCATCATTGCGGTTTCCACCCCAGTGATGATATCGAAAATTTCAGCAATCGACAGGAAGTTCAGACCTGTGAA
CTAGTCAATCTCGCTGACCTTGCGACAGACACCGAGTATGTTAGGGGACGACTCGCACAATATGGAAATGACTTG
TTATCGCTCGGAGTCGACGGAATGAGGTTGGATGCTGCTAAGCATATTTCTGCTGGAGATCTCTCGAATATCCTT
GGTAGATTATCCCGAAGGCCATATATCTCGCAGGAAGTCATTTTCGGTGGAGGGGAGCCTATACAACCTTCGGAG
TACACTGGAAACGGCGACGTACAAGAATTCAGATACACTACAACAATAAGGGACGCCTTTTCAGGGGGAGGCATT
TCAAGTCTTCAGAACCTGGATAATCGAGGTTGGGTCGCTGGCAACCGAGCGAATGTCTTTGTCGCGAATCATGAC
ACCGAACGCAATGGAGGCTCCCTAAGATATGATTCTTCTTCCAATACATATATCACGGCAACGATCTTTTCTCTT
GCACATCCATATGGAACTCCCACCATCATTTCGAGTTATAATATTCCCAACAATGACGCCGGCGCACCCAATGGC
GGCTCCGGATCTTGTAGCACAACTGGAGGAGCAAACGGCTGGCTTTGTCAACATCGTTTCGTTGCCATCACTGGA
ATGGTAGGATTCCGCAACAATGTAGGCTCAGCTACGTTAAATAACTGGGTGTCGCCACAATCTCAACAAATCGCC
TTTGGCCGTGGTTCACTTGGTTATGTGGCGATAAATAATGGAAATTCACAATGGAGCTCCACTTTTACTACGTCA
TTGCCAGACGGAACGTATTGTGATGTGATCAGGGGAACGGTCAGTAATGGAAGATGCTCAGGGCCTTCGTGA
Gene >AgabiH97|022180
ATGTTGAAATGGTCTATATTGTTTCTTTCCCTCTTTCAAACAATTCAAGCCGCTCCATTTGCGTTTAATGCGACG
CTTGATAAACGCGCCCCTAGCGGAAATAAAAATGTGATCATACAATTGTTCGAATGGAACTGGGATTCTGTAGCT
GCTGAATGTCGAAACTTTATCGGACCTCATGGCTATGGTTTTGTTCAAGGTTAGTCTCAATATTCTTAAATCTAT
CGATAAATCTTCCTTCTAATATGAATCAGTGAGCCCGCCGCAGGAGCACATAACTGGCTCTCAGTGGTGGACCGA
TTATCAACCCGTTTCGTACACGCTCACGTCGAAACGCGGAAACCGCTCCCAGTTCCAGAAGTTAGTCATGTACCA
TTTCCAGCACCATTGCATCCATGTGAAACCCTGTTTTTCAGCATGATAAACGCTTGTCATTCTGCTGGAGTAGGC
GTCATAGTTGGTATGTTACGTTAACTTCTCTTTACTGATTATCATTGTTCGCTTGATCTGATTATATTTTTGGCT
AGACACGATTTTCAATCACATGGCTGGTATCGACTCGGGCTCAGGCGTCGGAGGAAGTTCTTTCAGTCATTACAA
CTATCCCGGTATCTACCAGGTTCAAGACTTCCATCATTGCGGTTTCCACCCCAGTGATGATATCGAAAATTTCAG
CAATCGACAGGAAGTTCAGACCTGTGAACTAGTCAATCTCGCTGAGTAAAGTCATCCCTAAGTGGATAAAAAGGT
AATTTGTACTAATAGATTAAATTTGTAGCCTTGCGACAGACACCGAGTATGTTAGGGGACGACTCGCACAATATG
GAAATGACTTGTTATCGCTCGGAGTCGACGGAATGAGGTTGGATGCTGCTAAGCGTAAACTTCCTTCCACGTCTC
TCTTGCCTGTTTTCGCTCACTGTTGATTCATATAGATATTTCTGCTGGAGATCTCTCGAATATCCTTGGTAGATT
ATCCCGAAGGCCATATATCTCGCAGGAAGTCATTTTCGGTGGAGGGGAGCCTATACAACCTTCGGAGTACACTGG
AAACGGCGACGTACAAGAGTAAGACTTTTGAATGTGTTTCTGGGTGATGATGATTTCTAATGAAACGATTCACCA
GATTCAGATACACTACAACAATAAGGGACGCCTTTTCAGGGGGAGGCATTTCAAGTCTTCAGAACCTGGATAATC
GAGGTTGGGTCGCTGGCAACCGAGCGAATGTCTTTGTCGCGAATCATGACACCGAACGCGTAAGCTGGCTTCTTT
CTGCTTATTCCTATTGAAGTGAACGCTGAGTCCTTTTAGAATGGAGGCTCCCTAAGATATGATTCTTCTTCCAAT
ACATATATCACGGCAACGATCTTTTCTCTTGCACATCCATATGGAACTCCCACCATCATTTCGAGTTATAATATT
CCCAACAATGACGCCGGCGCACCCAATGGCGGTAAATCAAATTTTCTGACATGTTAATTCTTCCTTGTTCCCATT
CAAAAATCATAGGCTCCGGATCTTGTAGCACAACTGGAGGAGCAAACGGCTGGCTTTGTCAACATCGTTTCGTTG
CCATCACTGGAATGGTAGGATTCCGCAACAATGTAGGCTCAGCTACGTTAAATAACTGGGTGTCGCCACAATCTC
AACAAATCGCCTTTGGCCGTGGTTCACTTGGTTATGTGGCGATAAATAATGGAAATTCACAATGGAGCTCCACTT
TTACTACGTCATTGCCAGACGGAACGTATTGTGATGTGATCAGGGGAACGGTCAGTAATGGAAGATGCTCAGGGC
CTTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail