Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|021450
Gene name
Locationscaffold_10:1741134..1744179
Strand-
Gene length (bp)3045
Transcript length (bp)2244
Coding sequence length (bp)2244
Protein length (aa) 748

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10300 Iml2-TPR_39 Iml2/Tetratricopeptide repeat protein 39 6.7E-77 150 633

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q28DB0|TT39B_XENTR Tetratricopeptide repeat protein 39B OS=Xenopus tropicalis GN=ttc39b PE=2 SV=1 151 742 5.0E-73
sp|Q5XHH9|TT39B_XENLA Tetratricopeptide repeat protein 39B OS=Xenopus laevis GN=ttc39b PE=2 SV=1 151 742 3.0E-71
sp|Q95LT8|TT39B_MACFA Tetratricopeptide repeat protein 39B OS=Macaca fascicularis GN=TTC39B PE=2 SV=1 80 739 1.0E-65
sp|Q5VTQ0|TT39B_HUMAN Tetratricopeptide repeat protein 39B OS=Homo sapiens GN=TTC39B PE=1 SV=4 149 739 2.0E-65
sp|D3ZC96|TT39B_RAT Tetratricopeptide repeat protein 39B OS=Rattus norvegicus GN=Ttc39b PE=3 SV=1 149 739 1.0E-63
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q28DB0|TT39B_XENTR Tetratricopeptide repeat protein 39B OS=Xenopus tropicalis GN=ttc39b PE=2 SV=1 151 742 5.0E-73
sp|Q5XHH9|TT39B_XENLA Tetratricopeptide repeat protein 39B OS=Xenopus laevis GN=ttc39b PE=2 SV=1 151 742 3.0E-71
sp|Q95LT8|TT39B_MACFA Tetratricopeptide repeat protein 39B OS=Macaca fascicularis GN=TTC39B PE=2 SV=1 80 739 1.0E-65
sp|Q5VTQ0|TT39B_HUMAN Tetratricopeptide repeat protein 39B OS=Homo sapiens GN=TTC39B PE=1 SV=4 149 739 2.0E-65
sp|D3ZC96|TT39B_RAT Tetratricopeptide repeat protein 39B OS=Rattus norvegicus GN=Ttc39b PE=3 SV=1 149 739 1.0E-63
sp|Q8BYY4|TT39B_MOUSE Tetratricopeptide repeat protein 39B OS=Mus musculus GN=Ttc39b PE=1 SV=1 71 739 3.0E-63
sp|A2ACP1|TT39A_MOUSE Tetratricopeptide repeat protein 39A OS=Mus musculus GN=Ttc39a PE=2 SV=1 151 738 7.0E-60
sp|A1A5Y5|TT39A_DANRE Tetratricopeptide repeat protein 39A OS=Danio rerio GN=ttc39a PE=2 SV=1 151 742 4.0E-53
sp|Q5SRH9|TT39A_HUMAN Tetratricopeptide repeat protein 39A OS=Homo sapiens GN=TTC39A PE=2 SV=1 137 681 2.0E-52
sp|Q09266|YQD6_CAEEL Uncharacterized protein C32D5.6 OS=Caenorhabditis elegans GN=C32D5.6 PE=4 SV=1 140 742 1.0E-49
sp|Q28D40|TT39A_XENTR Tetratricopeptide repeat protein 39A OS=Xenopus tropicalis GN=ttc39a PE=2 SV=1 151 681 3.0E-47
sp|Q0VGK2|TT39C_RAT Tetratricopeptide repeat protein 39C OS=Rattus norvegicus GN=Ttc39c PE=2 SV=1 300 744 1.0E-23
sp|Q8VE09|TT39C_MOUSE Tetratricopeptide repeat protein 39C OS=Mus musculus GN=Ttc39c PE=1 SV=2 300 744 6.0E-23
sp|Q8N584|TT39C_HUMAN Tetratricopeptide repeat protein 39C OS=Homo sapiens GN=TTC39C PE=2 SV=2 300 744 1.0E-22
sp|Q1LXE6|TT39C_DANRE Tetratricopeptide repeat protein 39C OS=Danio rerio GN=ttc39c PE=2 SV=1 130 557 1.0E-18
sp|A6ZZY2|YKR18_YEAS7 Mitochondrial outer membrane protein SCY_3392 OS=Saccharomyces cerevisiae (strain YJM789) GN=SCY_3392 PE=3 SV=1 317 593 2.0E-10
sp|P36114|YKR18_YEAST Mitochondrial outer membrane protein YKR018C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKR018C PE=1 SV=1 317 593 3.0E-10
sp|O13693|YDYE_SCHPO Uncharacterized protein C11E3.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11E3.14 PE=2 SV=1 312 633 8.0E-08
sp|A8NVW1|IML2_COPC7 Mitochondrial outer membrane protein IML2 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=IML2 PE=3 SV=2 312 563 5.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|021450
MTLESLQRPIAGAQKNGSWVWSVHLAVTALGGQQKSPGVMKKRGYRENHDQRSRCCSYLLPVLPFNFHHMALQVL
NNVPISDDSTTGDSTACSASHGPNETGKTPATSDASSVEEAGASWKSNHNSELPPTVERPYTPDEALGDIPGVAY
ALERFLSSHMLESEEYCHKMDEPKERLYFATGYGLIQCVKGIMSYEDEDLLAGIRHTKHGNQIASEHRKKQAFLG
SRLAGYVVSSLSSGVSHIKGMTSVERHAELVYAESLFEKALLGIVYSGDWLAFIKEALNMRTTIGIYRQLGQFLD
SADAEAVAAGHGPTDKTIDIHFRSGVYLGIGMSHLILSLMPGKLMTFVELFGYRGDRKLGLKALMKAGGWTQEKE
EPEISAKEEGVRRSICDMALLIFHLVLSSFTFDCVDISIAAKILKWNLKRYPNGVFFLFGAGRLAVCQSQPKLAV
HYYTKAMESQKQYRNLHHISYWEIALANLALWNIPASLECWTHLKAEATWSKSTYAYGMAVCLLEIGDEKQKEEA
VMIMKKVPELRQRIAGKSIPLEKFVARKARKFLQQGNRLALPALELSYIFLGIAHAPREVIVNKMLPEIEKLLTK
LDTHKSDSKKYEGGSYWDDYCLAHFLQGVCLRYAAYPDPDAVLDPNETLKIPKEEAATKSEEAFRHVLENGPKIT
LDHHIVYYTHYELGRLLACQGHHDAARNEFELVTSGKYLEVGPSGRKGKYSMENALQMRCHAALDAIHQKRL*
Coding >AgabiH97|021450
ATGACCCTTGAAAGTTTGCAGCGGCCGATTGCTGGTGCTCAGAAGAATGGTAGTTGGGTGTGGTCAGTTCACCTG
GCCGTCACTGCTTTAGGTGGCCAGCAAAAGTCACCTGGTGTAATGAAGAAGAGGGGGTATAGGGAAAATCATGAC
CAGCGGTCACGCTGCTGCTCATATCTACTTCCAGTCCTTCCTTTTAACTTCCACCACATGGCTCTTCAGGTTCTC
AACAATGTCCCTATCAGCGACGACAGCACCACTGGCGACTCCACTGCATGCTCCGCCTCGCACGGCCCCAACGAG
ACTGGCAAAACACCCGCTACTTCCGACGCCTCTTCAGTAGAGGAGGCGGGGGCGTCTTGGAAGTCCAATCACAAC
TCGGAATTGCCTCCAACTGTCGAAAGACCCTACACTCCAGACGAAGCTTTGGGTGACATCCCCGGAGTCGCCTAT
GCACTTGAGCGTTTCCTATCTTCTCACATGTTGGAGTCCGAAGAGTATTGCCATAAGATGGATGAACCCAAAGAG
CGTCTATATTTCGCCACTGGATATGGGCTCATACAATGTGTCAAAGGCATAATGTCATACGAAGATGAAGATCTT
CTGGCTGGCATTCGACATACCAAGCATGGCAATCAGATTGCTAGTGAACACCGCAAGAAGCAAGCTTTCCTCGGT
TCACGTCTGGCTGGCTATGTCGTCTCTTCTCTTAGTTCTGGCGTCAGTCATATCAAAGGTATGACCTCGGTGGAG
CGACATGCCGAACTGGTATACGCGGAAAGCCTTTTTGAGAAGGCACTGCTTGGGATTGTCTATTCTGGTGACTGG
CTAGCGTTCATCAAAGAAGCACTAAACATGCGAACTACGATTGGAATTTATCGACAACTTGGTCAATTTTTGGAC
TCCGCGGATGCCGAAGCCGTTGCCGCGGGCCACGGACCCACTGACAAGACGATCGATATTCACTTCCGTTCCGGT
GTCTATCTCGGTATCGGGATGAGCCACCTCATCCTGAGCCTCATGCCTGGCAAGCTTATGACATTTGTCGAGTTG
TTCGGGTACCGTGGTGACCGCAAGCTTGGTCTGAAAGCCCTGATGAAGGCTGGAGGATGGACGCAGGAGAAGGAA
GAGCCTGAAATTAGTGCCAAGGAGGAAGGCGTGAGACGCAGCATTTGCGATATGGCCCTCCTCATCTTTCATCTC
GTTCTTTCGAGCTTTACTTTCGATTGTGTCGATATTTCCATCGCCGCTAAAATCTTAAAATGGAATCTGAAGCGA
TACCCTAATGGCGTTTTCTTCTTATTTGGTGCTGGCCGCCTCGCCGTATGTCAATCTCAGCCCAAGTTGGCTGTT
CACTATTACACGAAGGCAATGGAGTCTCAAAAACAATATCGCAATCTACATCATATTTCTTACTGGGAGATAGCT
CTTGCTAATCTGGCCCTGTGGAATATACCCGCTAGTCTGGAATGTTGGACTCACTTAAAGGCAGAAGCGACATGG
TCGAAATCCACCTATGCTTATGGAATGGCTGTATGTTTGTTGGAAATAGGGGATGAAAAGCAGAAGGAAGAAGCT
GTGATGATAATGAAGAAAGTTCCGGAGCTAAGGCAGAGAATAGCCGGAAAGTCGATTCCGCTTGAGAAATTCGTG
GCCCGTAAAGCTCGCAAATTTTTACAACAAGGCAATCGACTTGCTCTTCCAGCCCTCGAGCTCTCGTACATTTTC
CTTGGTATCGCGCATGCCCCTCGAGAGGTGATCGTGAACAAAATGTTGCCGGAAATAGAGAAGTTGTTGACCAAA
CTTGATACCCACAAATCGGATTCGAAGAAGTACGAAGGAGGTAGTTATTGGGATGACTACTGTTTGGCCCATTTC
CTCCAAGGTGTTTGTCTTCGTTACGCGGCATATCCTGACCCAGACGCCGTTCTTGACCCGAATGAAACTCTGAAA
ATTCCAAAGGAAGAAGCAGCGACTAAATCCGAGGAAGCATTTCGGCATGTACTTGAAAATGGTCCTAAAATCACA
CTAGACCATCACATTGTCTATTACACTCATTATGAATTGGGTCGATTGCTAGCCTGCCAAGGACATCACGACGCT
GCTCGAAATGAATTTGAACTGGTCACATCCGGCAAATATCTTGAGGTTGGACCATCCGGTAGAAAGGGGAAGTAT
AGTATGGAGAATGCCTTGCAAATGCGATGTCATGCCGCCCTGGATGCAATTCACCAGAAACGCCTATAA
Transcript >AgabiH97|021450
ATGACCCTTGAAAGTTTGCAGCGGCCGATTGCTGGTGCTCAGAAGAATGGTAGTTGGGTGTGGTCAGTTCACCTG
GCCGTCACTGCTTTAGGTGGCCAGCAAAAGTCACCTGGTGTAATGAAGAAGAGGGGGTATAGGGAAAATCATGAC
CAGCGGTCACGCTGCTGCTCATATCTACTTCCAGTCCTTCCTTTTAACTTCCACCACATGGCTCTTCAGGTTCTC
AACAATGTCCCTATCAGCGACGACAGCACCACTGGCGACTCCACTGCATGCTCCGCCTCGCACGGCCCCAACGAG
ACTGGCAAAACACCCGCTACTTCCGACGCCTCTTCAGTAGAGGAGGCGGGGGCGTCTTGGAAGTCCAATCACAAC
TCGGAATTGCCTCCAACTGTCGAAAGACCCTACACTCCAGACGAAGCTTTGGGTGACATCCCCGGAGTCGCCTAT
GCACTTGAGCGTTTCCTATCTTCTCACATGTTGGAGTCCGAAGAGTATTGCCATAAGATGGATGAACCCAAAGAG
CGTCTATATTTCGCCACTGGATATGGGCTCATACAATGTGTCAAAGGCATAATGTCATACGAAGATGAAGATCTT
CTGGCTGGCATTCGACATACCAAGCATGGCAATCAGATTGCTAGTGAACACCGCAAGAAGCAAGCTTTCCTCGGT
TCACGTCTGGCTGGCTATGTCGTCTCTTCTCTTAGTTCTGGCGTCAGTCATATCAAAGGTATGACCTCGGTGGAG
CGACATGCCGAACTGGTATACGCGGAAAGCCTTTTTGAGAAGGCACTGCTTGGGATTGTCTATTCTGGTGACTGG
CTAGCGTTCATCAAAGAAGCACTAAACATGCGAACTACGATTGGAATTTATCGACAACTTGGTCAATTTTTGGAC
TCCGCGGATGCCGAAGCCGTTGCCGCGGGCCACGGACCCACTGACAAGACGATCGATATTCACTTCCGTTCCGGT
GTCTATCTCGGTATCGGGATGAGCCACCTCATCCTGAGCCTCATGCCTGGCAAGCTTATGACATTTGTCGAGTTG
TTCGGGTACCGTGGTGACCGCAAGCTTGGTCTGAAAGCCCTGATGAAGGCTGGAGGATGGACGCAGGAGAAGGAA
GAGCCTGAAATTAGTGCCAAGGAGGAAGGCGTGAGACGCAGCATTTGCGATATGGCCCTCCTCATCTTTCATCTC
GTTCTTTCGAGCTTTACTTTCGATTGTGTCGATATTTCCATCGCCGCTAAAATCTTAAAATGGAATCTGAAGCGA
TACCCTAATGGCGTTTTCTTCTTATTTGGTGCTGGCCGCCTCGCCGTATGTCAATCTCAGCCCAAGTTGGCTGTT
CACTATTACACGAAGGCAATGGAGTCTCAAAAACAATATCGCAATCTACATCATATTTCTTACTGGGAGATAGCT
CTTGCTAATCTGGCCCTGTGGAATATACCCGCTAGTCTGGAATGTTGGACTCACTTAAAGGCAGAAGCGACATGG
TCGAAATCCACCTATGCTTATGGAATGGCTGTATGTTTGTTGGAAATAGGGGATGAAAAGCAGAAGGAAGAAGCT
GTGATGATAATGAAGAAAGTTCCGGAGCTAAGGCAGAGAATAGCCGGAAAGTCGATTCCGCTTGAGAAATTCGTG
GCCCGTAAAGCTCGCAAATTTTTACAACAAGGCAATCGACTTGCTCTTCCAGCCCTCGAGCTCTCGTACATTTTC
CTTGGTATCGCGCATGCCCCTCGAGAGGTGATCGTGAACAAAATGTTGCCGGAAATAGAGAAGTTGTTGACCAAA
CTTGATACCCACAAATCGGATTCGAAGAAGTACGAAGGAGGTAGTTATTGGGATGACTACTGTTTGGCCCATTTC
CTCCAAGGTGTTTGTCTTCGTTACGCGGCATATCCTGACCCAGACGCCGTTCTTGACCCGAATGAAACTCTGAAA
ATTCCAAAGGAAGAAGCAGCGACTAAATCCGAGGAAGCATTTCGGCATGTACTTGAAAATGGTCCTAAAATCACA
CTAGACCATCACATTGTCTATTACACTCATTATGAATTGGGTCGATTGCTAGCCTGCCAAGGACATCACGACGCT
GCTCGAAATGAATTTGAACTGGTCACATCCGGCAAATATCTTGAGGTTGGACCATCCGGTAGAAAGGGGAAGTAT
AGTATGGAGAATGCCTTGCAAATGCGATGTCATGCCGCCCTGGATGCAATTCACCAGAAACGCCTATAA
Gene >AgabiH97|021450
ATGACCCTTGAAAGTTTGCAGCGGCCGATTGCTGGTGCTCAGAAGAATGGTAGTTGGGTGTGGTCAGTTCACCTG
GCCGTCACTGCTTTAGGTGAGCGCAGAATCTGAGCCAAGGAGTGCAACTGACGCGAGGTTTCGTTTCTGGCGGCC
TAGGTGGCCAGCAAAAGTCACCTGGTGTCATTGCCTCACGGACACATTGGCGAGGCTGTGCCGGATAAGGTGTAA
TGAAGAAGAGGGGGTATAGGGAAAATCATGACCAGGCGCGTGAATTGAAGCAGTTCTGAATTTTCTTTGTAACAT
ACCCGCCTGGCTATTCCCATCACTAGCGGTCACGCTGCTGCTCATATCTACTTCCAGTCCTTCCTTTTAACTTCC
ACCACATGGCTCTTCAGGTTCTCAACAATGTCCCTATCAGCGACGACAGCACCACTGGCGACTCCACTGCATGCT
CCGCCTCGCACGGCCCCAACGAGACTGGCAAAACACCCGCTACTTCCGACGCCTCTTCAGTAGAGGAGGCGGGGG
CGTCTTGGAAGTCCAATCACAACTCGGAATTGCCTCCAACTGTCGAAAGACCCTACACTCCAGACGAAGCTTTGG
GTGACATCCCCGGAGTCGCCTATGCACTTGAGCGTTTCCTATCTTCTCACATGTTGGAGTCCGAAGAGTATTGCC
ATAAGATGGATGAACCCAAGTGCGTAATTACTCCCTTTCAACCTTCAGTGTTTAACCTGTCCAGCACAGAGAGCG
TCTATATTTCGCCACTGGATATGGGCTCATACAATGTGTCAAAGGCATAATGTCATACGAAGATGAAGTGCGTAC
TTCGAGGATGTTCCACGTTGACCACTCGTACCGACCGCACCTTTACCACAGGATCTTCTGGCTGGCATTCGACAT
ACCAAGCATGGCAATCAGATTGCTAGTGAACACCGCAAGAAGCAAGCTTTCCTCGGTTCACGTCTGGCTGGCTAT
GTCGTCTCTTCTCTTAGTTCTGGCGTCAGTCATATCAAAGGTATGACCTCGGTGGAGCGACATGCCGAACTGGTA
TACGCGGAAAGCCTTTTTGAGAAGGTGAGAATTTTTCGGTAGCAATCCTTTTCCGGGACTCATCCGCTCTGCAGG
CACTGCTTGGGATTGTCTATTCTGGTGACTGGCTAGCGTTCATCAAAGAAGCGTGAGTTATCTTCTCGAGTTCAT
GAACTTGCTAGCTAAATTCTTCTAGACTAAACATGCGAACTACGATTGGAATTTATCGACAACTTGGTCAATTTT
TGGACTCCGCGGATGCCGAAGCCGTTGCCGCGGGCCACGGACCCACTGACAAGACGATCGATATTCACTTCCGTT
CCGGTGTCTATCTCGGTATCGGGATGAGCCACCTCATCCTGAGCCTCATGCCTGGCAAGCTTATGACATTTGTCG
AGTTGTTCGGGTACCGTGGTGACCGCAAGCTTGGTCTGAAAGCCCTGATGAAGGCTGGAGGATGGACGCAGGAGA
AGGAAGAGCCTGAAATTAGTGCCAGTACGCGAAAAGTTGCATTTTCCTTGATCGAAAATTAACTGTGACCCCTAG
AGGAGGAAGGCGTGAGACGCAGCATTTGCGATATGGCCCTCCTCATCTTTCATCTCGTTCTTTCGAGCTTTACTT
TCGATTGTGTCGATATTTCCATCGCCGCTAAAATCTTAAAATGGAATCTGAAGCGATACCCTAATGGTTCGTCAA
TGGTTCCCCTTCGAGTTTCCGTTCTGACGGGCTTCTAGGCGTTTTCTTCTTATTTGGTGCTGGCCGCCTCGCCGT
ATGTCAATCTCAGCCCAAGTTGGCTGTTCACTATTACACGAAGGCAATGGAGTCTCAAAAACAATATCGCAATCT
ACATCATATTTCTTACTGGGAGATAGCTCTTGCTAATCTGGCCCTGTGGAATATACCCGCTAGTCTGGAATGTTG
GACTCACTTAAAGGCAGAAGCGACAGTAAGTCACGTCACTTCCGCCTTGATTTCCACTGAACCAAGGAACTATGC
AGTGGTCGAAATCCACCTATGCTTATGGAATGGCTGTATGTTTGTTGGAAATAGGGGATGAAAAGCAGAAGGAAG
AAGCTGTGATGATAATGAAGAAAGTTCCGGAGCTAAGGCAGAGAATAGCCGGAAAGTCGATTCCGCTTGAGGTGA
GGAGCAATATCTATCATTTTGACATTGAGCTCTGAAAAAGTTTATAGAAATTCGTGGCCCGTAAAGCTCGCAAAT
TTTTACAACAAGGCAATCGACTTGCTCTTCCAGCCCTCGAGCTCTCGTACATTTTCCTTGGTATCGCGCATGCCC
CTCGAGAGGTGATCGTGAACAAAATGTTGCCGGAAATAGAGAAGTTGTTGACCAAACTTGATACCCACAAATCGG
ATTCGAAGAAGTACGAAGGAGGTAGTTATTGGGATGACTACTGTTTGGCCCATTTCCTCCAAGGTGTTTGTCTTC
GTTACGCGGCATATCCTGTCAGTTGCATTCGTTTCTTCAATTTTTACCCCACCTTATTCTTGAAATAGGACCCAG
ACGCCGTTCTTGACCCGAATGAAACTCTGAAAATTCCAAAGGAAGAAGCAGCGACTAAATCCGAGGAAGCATTTC
GGCATGTACTTGAAAATGGTCCTAAAATCACACTAGACCATCACATTGTCTATTACACTCGTACGTCTAATTTTT
CAAAGCCAGACGGCATAAACTAAACGCAACCCCCATGTAGATTATGAATTGGGTCGATTGCTAGCCTGCCAAGGA
CATCACGACGCTGCTCGAAATGAATTTGAACTGGTCACATCCGGCAAATATCTTGAGGTTGGACCATCCGGTAGA
AAGGTGAGGCATCATGGCGTGAACTTCTTTTATAATTTGAAATTAAATTTTCTTTCTCTCGTAACAGGGGAAGTA
TAGTATGGAGGTATGATAAATGACATCCTTCCTTACGAAATATCTGACCACCATATCTAGAATGCCTTGCAAATG
CGATGTCATGCCGCCCTGGATGCAATTCACCAGAAACGCCTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail