Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|021440
Gene name
Locationscaffold_10:1738443..1740443
Strand+
Gene length (bp)2000
Transcript length (bp)1431
Coding sequence length (bp)1431
Protein length (aa) 477

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.5E-39 53 428

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 9 475 7.0E-89
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 1 476 9.0E-72
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 2 476 1.0E-71
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 37 473 3.0E-71
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 37 476 1.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 9 475 7.0E-89
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 1 476 9.0E-72
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 2 476 1.0E-71
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 37 473 3.0E-71
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 37 476 1.0E-66
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 32 475 3.0E-65
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 39 474 2.0E-64
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 1 475 1.0E-63
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 2 472 9.0E-63
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 2 476 1.0E-62
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 10 475 1.0E-62
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 28 473 2.0E-61
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 29 471 2.0E-61
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 2 471 3.0E-61
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 32 475 2.0E-60
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 28 473 9.0E-60
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 13 475 1.0E-55
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 1 474 2.0E-51
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 29 470 3.0E-51
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 28 475 5.0E-51
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 28 475 5.0E-51
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 29 470 2.0E-50
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 28 476 8.0E-48
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 69 448 2.0E-47
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 4 475 5.0E-47
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 5 474 4.0E-42
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 2 476 8.0E-41
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 8 475 5.0E-38
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 26 245 4.0E-21
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 67 221 4.0E-17
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 31 222 1.0E-12
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 60 222 1.0E-10
sp|G2TRN8|YI74_SCHPO Putative uncharacterized transporter C977.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.04 PE=5 SV=1 326 470 6.0E-10
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 97 204 7.0E-10
sp|P28246|BCR_ECOLI Bicyclomycin resistance protein OS=Escherichia coli (strain K12) GN=bcr PE=1 SV=4 69 224 1.0E-09
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 72 426 2.0E-09
sp|Q7Z118|YMPB_CAEEL Putative transporter B0361.11 OS=Caenorhabditis elegans GN=B0361.11 PE=3 SV=2 84 247 4.0E-09
sp|P37498|YYBF_BACSU Uncharacterized MFS-type transporter YybF OS=Bacillus subtilis (strain 168) GN=yybF PE=3 SV=1 72 196 5.0E-09
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 7 221 8.0E-09
sp|Q43975|PCAK_ACIAD 4-hydroxybenzoate transporter PcaK OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaK PE=1 SV=3 90 249 1.0E-07
sp|P0A0J9|QACA_STAAU Antiseptic resistance protein OS=Staphylococcus aureus GN=qacA PE=1 SV=1 40 238 2.0E-07
sp|P0A0J8|QACA_STAAM Antiseptic resistance protein OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=qacA PE=3 SV=1 40 238 2.0E-07
sp|P46105|ACT22_STRCO Probable actinorhodin transporter OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actII-2 PE=3 SV=1 37 228 3.0E-07
sp|Q1RI77|BCRH_RICBR Uncharacterized transporter RBE_0856 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0856 PE=3 SV=1 69 200 3.0E-07
sp|P39386|MDTM_ECOLI Multidrug resistance protein MdtM OS=Escherichia coli (strain K12) GN=mdtM PE=1 SV=1 68 221 2.0E-06
sp|P96709|YDGK_BACSU Uncharacterized MFS-type transporter YdgK OS=Bacillus subtilis (strain 168) GN=ydgK PE=3 SV=1 69 208 3.0E-06
sp|P32482|CMLA_PSEAI Chloramphenicol resistance protein OS=Pseudomonas aeruginosa GN=cmlA PE=3 SV=2 75 223 6.0E-06
sp|Q8XB84|MDTM_ECO57 Multidrug resistance protein MdtM OS=Escherichia coli O157:H7 GN=mdtM PE=3 SV=1 68 221 8.0E-06
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 38 220 9.0E-06
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 38 220 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

Domain # Start End Length
1 42 64 22
2 79 101 22
3 113 135 22
4 139 161 22
5 168 190 22
6 205 227 22
7 270 292 22
8 307 329 22
9 349 368 19
10 373 395 22
11 416 438 22
12 443 465 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|021440
MSPSSTDHEKELSKDDNHDNCASSRILQEHEHPQHLPTWRKWLAVSVTGSASACVTATSSMAAFAEDGVSADFHV
GHTVSVLQISLYVLGLGLGPMVLGPLSEIYGRRPVYRSSYGLFFALSWPVAFAPNIGVFLAFRFITGICGAAFLS
VPGGSISDMFSDQTVATPMAVYTICPFLGPVVGPVVSGFINDHLDWRWTYYIILMWAFGQLIAIFLFIPETYVPV
LIKAKLIRQNLHHASETKMHTVKHVAKAIAFSCYTPFRLLFSDMMALLLDTWNAVILGILYLAFQVFPIIFEGGH
GFTVQETGLGYLGIGLGMIIGLATQPYWNRFYIRVSQRNGGILPPEARLYMGQVGGICVSVGLFWLAFTTYPAVP
WIVPILASVPFGCGIYFVYASTFTYLVTTYRPIAASAMAANSAMRSTFAAVFPLFAGALYARLGTVGATALMAGI
TAIMAPFPFIFARLGPRLRKKSKLAV*
Coding >AgabiH97|021440
ATGTCACCGTCATCCACAGACCATGAAAAGGAACTCAGTAAAGACGACAACCACGATAACTGCGCTTCTTCGAGG
ATACTGCAAGAACATGAACATCCCCAGCATCTTCCAACTTGGCGGAAATGGCTGGCTGTTTCTGTAACTGGCTCT
GCTTCAGCATGCGTAACAGCCACCTCTTCTATGGCTGCGTTTGCTGAGGATGGTGTTTCTGCCGATTTTCACGTT
GGGCATACCGTTTCCGTGTTACAAATCAGCCTATACGTACTGGGCTTAGGGCTAGGGCCTATGGTCCTTGGGCCT
CTGTCAGAAATTTACGGAAGAAGGCCTGTGTATCGCTCATCGTATGGGTTGTTCTTCGCCCTTTCATGGCCTGTC
GCATTTGCACCCAATATTGGTGTATTCCTCGCCTTCAGATTTATTACTGGTATTTGTGGAGCCGCTTTTTTGAGT
GTCCCCGGAGGGAGTATCAGTGACATGTTCTCAGATCAGACAGTCGCAACACCCATGGCGGTTTACACAATTTGT
CCTTTTTTGGGTCCTGTAGTTGGTCCCGTTGTTAGTGGCTTCATCAATGACCATCTGGACTGGCGCTGGACATAT
TATATCATTCTCATGTGGGCCTTTGGCCAGCTCATCGCTATCTTTCTTTTTATACCCGAGACTTATGTGCCTGTT
CTAATCAAAGCAAAGCTTATCCGCCAAAATCTACATCATGCATCGGAAACAAAAATGCACACCGTAAAACATGTG
GCCAAGGCAATAGCGTTTAGCTGTTACACACCCTTTAGGCTTCTATTTTCCGACATGATGGCATTACTTCTAGAC
ACATGGAACGCTGTCATTTTGGGCATCCTCTATTTGGCTTTCCAAGTTTTTCCCATTATTTTTGAGGGCGGCCAC
GGGTTCACTGTTCAGGAGACTGGGCTCGGATATCTGGGTATTGGATTAGGTATGATTATTGGCTTGGCAACTCAG
CCATATTGGAATAGATTTTATATAAGAGTTTCACAAAGGAACGGGGGGATCCTACCCCCAGAAGCACGACTTTAT
ATGGGACAAGTAGGAGGCATCTGTGTATCTGTCGGTCTGTTCTGGCTGGCTTTCACAACTTACCCTGCCGTACCT
TGGATCGTTCCAATTTTGGCTTCGGTCCCATTTGGCTGTGGGATTTATTTTGTATATGCGTCAACGTTCACGTAT
CTCGTCACAACTTATAGGCCTATTGCTGCTTCTGCGATGGCTGCGAATAGTGCGATGAGATCCACCTTTGCGGCT
GTCTTCCCGTTGTTTGCAGGAGCCCTGTACGCGAGGCTTGGTACCGTCGGTGCAACAGCTCTCATGGCTGGTATA
ACAGCTATCATGGCGCCATTCCCTTTTATATTCGCGCGTTTGGGGCCTCGCTTACGCAAAAAATCAAAACTCGCT
GTATGA
Transcript >AgabiH97|021440
ATGTCACCGTCATCCACAGACCATGAAAAGGAACTCAGTAAAGACGACAACCACGATAACTGCGCTTCTTCGAGG
ATACTGCAAGAACATGAACATCCCCAGCATCTTCCAACTTGGCGGAAATGGCTGGCTGTTTCTGTAACTGGCTCT
GCTTCAGCATGCGTAACAGCCACCTCTTCTATGGCTGCGTTTGCTGAGGATGGTGTTTCTGCCGATTTTCACGTT
GGGCATACCGTTTCCGTGTTACAAATCAGCCTATACGTACTGGGCTTAGGGCTAGGGCCTATGGTCCTTGGGCCT
CTGTCAGAAATTTACGGAAGAAGGCCTGTGTATCGCTCATCGTATGGGTTGTTCTTCGCCCTTTCATGGCCTGTC
GCATTTGCACCCAATATTGGTGTATTCCTCGCCTTCAGATTTATTACTGGTATTTGTGGAGCCGCTTTTTTGAGT
GTCCCCGGAGGGAGTATCAGTGACATGTTCTCAGATCAGACAGTCGCAACACCCATGGCGGTTTACACAATTTGT
CCTTTTTTGGGTCCTGTAGTTGGTCCCGTTGTTAGTGGCTTCATCAATGACCATCTGGACTGGCGCTGGACATAT
TATATCATTCTCATGTGGGCCTTTGGCCAGCTCATCGCTATCTTTCTTTTTATACCCGAGACTTATGTGCCTGTT
CTAATCAAAGCAAAGCTTATCCGCCAAAATCTACATCATGCATCGGAAACAAAAATGCACACCGTAAAACATGTG
GCCAAGGCAATAGCGTTTAGCTGTTACACACCCTTTAGGCTTCTATTTTCCGACATGATGGCATTACTTCTAGAC
ACATGGAACGCTGTCATTTTGGGCATCCTCTATTTGGCTTTCCAAGTTTTTCCCATTATTTTTGAGGGCGGCCAC
GGGTTCACTGTTCAGGAGACTGGGCTCGGATATCTGGGTATTGGATTAGGTATGATTATTGGCTTGGCAACTCAG
CCATATTGGAATAGATTTTATATAAGAGTTTCACAAAGGAACGGGGGGATCCTACCCCCAGAAGCACGACTTTAT
ATGGGACAAGTAGGAGGCATCTGTGTATCTGTCGGTCTGTTCTGGCTGGCTTTCACAACTTACCCTGCCGTACCT
TGGATCGTTCCAATTTTGGCTTCGGTCCCATTTGGCTGTGGGATTTATTTTGTATATGCGTCAACGTTCACGTAT
CTCGTCACAACTTATAGGCCTATTGCTGCTTCTGCGATGGCTGCGAATAGTGCGATGAGATCCACCTTTGCGGCT
GTCTTCCCGTTGTTTGCAGGAGCCCTGTACGCGAGGCTTGGTACCGTCGGTGCAACAGCTCTCATGGCTGGTATA
ACAGCTATCATGGCGCCATTCCCTTTTATATTCGCGCGTTTGGGGCCTCGCTTACGCAAAAAATCAAAACTCGCT
GTATGA
Gene >AgabiH97|021440
ATGTCACCGTCATCCACAGACCATGAAAAGGAACTCAGTAAAGACGACAACCACGATAACTGCGCTTCTTCGAGG
ATACTGCAAGAACATGAACATCCCCAGCATCTTCCAACTTGGCGGAAATGGCTGGCTGTTTCTGTAACTGGCTCT
GCTTCAGCATGCGTAACAGCCACCTCTTCTATGGTGAGACTTAGACTGAGAATTCTAACACACTCATAACTAAAC
TTGTATTGTTTTTATATAGGCTGCGTTTGCTGAGGATGGTGTTTCTGCCGATTTTCACGTTGGGCATACCGTTTC
CGTGTTACAAATCAGCCTATACGTACTGGGCTTAGGGCTAGGGCCTATGGTCCTTGGGCCTCTGTCAGAAATTTA
CGGAAGAAGGCCTGTGTATCGCTCATCGTATGGGTTGTTCTTCGCCCTTTCATGGCCTGTCGCATTTGCACCCAA
TATTGGTACGACACGTAGAAGGCGCATGAGATGAAGGTCATTTACGGTGATTTATAGGTGTATTCCTCGCCTTCA
GATTTATTACTGGTATTTGTGGAGCCGCTTTTTTGAGTGTCCCCGGAGGGAGTATCAGTGACATGTTCTCAGATC
AGACAGTCGCAACGTGAGTGTGTAACCCACTCTTATCATTACCACTAAATGTTGAGTTTCGAAGACCCATGGCGG
TTTACACAATTTGTCCTTTTTTGGGTCCTGTAGTTGGTCCCGTTGTTAGTGGGTACGTTTACACCTCTATCTCCT
GCTACTGAGAGTGACATAACCACCAGCTTCATCAATGACGTATGCAGAACCCCTGAACTAGAGAAACATTGATTC
AACAACTTTGTTAGCATCTGGACTGGCGCTGGACATATTATATCATTCTCATGTGGGCCTTTGGCCAGCTCATCG
CTATCTTTCTTGTGAGTCGATCACACACGACCGACCGAAGTCTAACGTCGGCACCCGAAAAACCAGTTTATACCC
GAGACTTATGTGCCTGTTCTAATCAAAGCAAAGCTTATCCGCCAAAATCTACATCATGCATCGGAAACAAAAATG
CACACCGTAAAACATGTGGCCAAGGCAATAGCGTTTAGCTGTTACACACCCTTTAGTAAGGTATACCACCTCTTT
GAAAGAAACTAATGGAACGACAATCTGGCAGGGCTTCTATTTTCCGACATGATGGCATTACTTCTAGACACATGG
TACGATCTAGTCTCTATCAGAGTATTACAGGCTCACGTTGCGTCAAGGAACGCTGTCATTTTGGGCATCCTCTAT
TTGGCTTTCCAAGTTTTTCCCATTATTTTTGAGGGCGGCCACGGGTTCACTGTTCAGGAGACTGGGCTCGGATAT
CTGGGTATTGGATTAGGTATGATTATTGGCTTGGCAACTCAGCCATATTGGAATAGGTACGTACGCTATACCTGA
TGACGACATTGAGATTTATCTGTCTAGCAGATTTTATATAAGAGTTTCACAAAGGAACGGGGGGATCCTACCCCC
AGAAGCACGACTTTATATGGGACAAGTAGGAGGCATCTGTGTATCTGTCGGTATGTGATATACCGATATAAGGGG
TCATAGTTTCTAATAGCCAGATAGGTCTGTTCTGGCTGGCTTTCACAACTTACCCTGCCGTACCTTGGATCGTTC
CAATTTTGGCTTCGGTCCCATTTGGCTGTGGGATTTATTTTGTATATGCGTCAACGTTCACGTATCTCGTCACAA
CTTATAGGCCTATTGCTGCTTCTGCGATGGCTGCGAATAGTGCGATGAGATCCACCTTTGCGGCTGTCTTCCCGT
TGTTTGCAGGAGCCCTGTACGCGAGGCTTGGTACCGTCGGTGCAACAGCTCTCATGGCTGGTATAACAGCTATCA
TGGCGCCATTCCCGTGAGATTTCTATTTCATTCAACCACATCTGCTAATTGATCTTCTTCGAAATAGTTTTATAT
TCGCGCGTTTGGGGCCTCGCTTACGCAAAAAATCAAAACTCGCTGTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail