Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|021380
Gene name
Locationscaffold_10:1717753..1718445
Strand+
Gene length (bp)692
Transcript length (bp)579
Coding sequence length (bp)579
Protein length (aa) 193

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04145 Ctr Ctr copper transporter family 2.9E-26 48 181

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q7YXD4|P80_DICDI Protein P80 OS=Dictyostelium discoideum GN=p80 PE=2 SV=1 48 187 3.0E-08

GO

GO Term Description Terminal node
GO:0005375 copper ion transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0035434 copper ion transmembrane transport Yes
GO:0005575 cellular_component No
GO:0098660 inorganic ion transmembrane transport No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0034220 ion transmembrane transport No
GO:0008150 biological_process No
GO:0030001 metal ion transport No
GO:0046915 transition metal ion transmembrane transporter activity No
GO:0006810 transport No
GO:0000041 transition metal ion transport No
GO:0051234 establishment of localization No
GO:0046873 metal ion transmembrane transporter activity No
GO:0006825 copper ion transport No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0098655 cation transmembrane transport No
GO:0003674 molecular_function No
GO:0006812 cation transport No
GO:0098662 inorganic cation transmembrane transport No
GO:0055085 transmembrane transport No
GO:0008324 cation transmembrane transporter activity No
GO:0009987 cellular process No
GO:0015075 ion transmembrane transporter activity No
GO:0031224 intrinsic component of membrane No
GO:0006811 ion transport No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 61 83 22
3 150 172 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|021380
MYSLNICAFIFFLALGQTSNAQSHTISHGMDMDMDMGMSLAFGQMLPYLHFSGSDILWFEGWVPQSKGATAGACI
GLFMLAIFDRWVSAMRSAAEVHWEEDAQIEFANHLNAPAKASGYQIISRMTLLRTIPPFIFANDVTRGFFCGAEA
LLGYAFMLALMTYNAGFMLSITSGLGVGEMLYGRYADRSDEC*
Coding >AgabiH97|021380
ATGTACTCTCTGAATATCTGCGCGTTTATCTTCTTCCTGGCACTGGGCCAGACAAGTAATGCTCAATCACACACA
ATCAGCCACGGAATGGATATGGACATGGATATGGGGATGAGCCTTGCTTTTGGGCAGATGCTTCCTTATCTTCAC
TTCTCCGGAAGTGATATATTGTGGTTTGAAGGCTGGGTACCGCAGAGTAAAGGTGCAACTGCCGGCGCATGTATT
GGTCTTTTCATGCTGGCCATTTTCGATCGATGGGTCAGTGCGATGAGATCTGCAGCGGAGGTTCATTGGGAGGAA
GACGCACAGATTGAGTTTGCCAACCATCTCAATGCACCCGCCAAAGCCTCAGGTTATCAGATCATATCGCGTATG
ACTCTACTGCGCACGATTCCACCCTTCATTTTCGCCAACGACGTTACTCGCGGTTTCTTTTGTGGCGCCGAAGCT
TTGTTGGGCTACGCTTTCATGCTCGCTCTTATGACATACAATGCCGGATTCATGTTATCGATCACTTCTGGACTG
GGCGTCGGGGAAATGCTTTACGGTCGATACGCTGATAGGAGCGATGAATGCTGA
Transcript >AgabiH97|021380
ATGTACTCTCTGAATATCTGCGCGTTTATCTTCTTCCTGGCACTGGGCCAGACAAGTAATGCTCAATCACACACA
ATCAGCCACGGAATGGATATGGACATGGATATGGGGATGAGCCTTGCTTTTGGGCAGATGCTTCCTTATCTTCAC
TTCTCCGGAAGTGATATATTGTGGTTTGAAGGCTGGGTACCGCAGAGTAAAGGTGCAACTGCCGGCGCATGTATT
GGTCTTTTCATGCTGGCCATTTTCGATCGATGGGTCAGTGCGATGAGATCTGCAGCGGAGGTTCATTGGGAGGAA
GACGCACAGATTGAGTTTGCCAACCATCTCAATGCACCCGCCAAAGCCTCAGGTTATCAGATCATATCGCGTATG
ACTCTACTGCGCACGATTCCACCCTTCATTTTCGCCAACGACGTTACTCGCGGTTTCTTTTGTGGCGCCGAAGCT
TTGTTGGGCTACGCTTTCATGCTCGCTCTTATGACATACAATGCCGGATTCATGTTATCGATCACTTCTGGACTG
GGCGTCGGGGAAATGCTTTACGGTCGATACGCTGATAGGAGCGATGAATGCTGA
Gene >AgabiH97|021380
ATGTACTCTCTGAATATCTGCGCGTTTATCTTCTTCCTGGCACTGGGCCAGACAAGTAATGCTCAATCACACACA
ATCAGCCACGGAATGGATATGGACATGGATATGGGGATGAGCCTTGCTTTTGGGCAGATGCTTCCTTATCTTCAC
TTCTCCGGAAGTGATATATTGTGGTTTGAAGGCTGGGTACCGCAGAGTAAAGGTGCAACTGCCGGCGCATGTATT
GGTCTTTTCATGCTGGCCATTTTCGATCGATGGGTCAGTGCGATGAGATCTGCAGCGGAGGTTCATTGGGAGGAA
GAGTATGTCTTGTCGTTCGGTAGCCGCGTCTCGTCTTCAGCTAACAAATGCACTTTTTAGCGCACAGATTGAGTT
TGCCAACCATCTCAATGCACCCGCCAAAGCCTCAGGTTATCAGATCATATCGCGTATGACTCTACTGCGCACGAT
TCCACCCTTCATTTTCGCCAACGACGTTACTCGCGGTTTCTTTTGTGGCGCCGAAGCTTTGTTGGGCTACGCTTT
CATGCTCGCTCTTATGTTAGTAGTTCTCTCAGATCGTAAACTTTTGAGAGACTGATTGATGTATTCTCAGGACAT
ACAATGCCGGATTCATGTTATCGATCACTTCTGGACTGGGCGTCGGGGAAATGCTTTACGGTCGATACGCTGATA
GGAGCGATGAATGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail