Protein ID | AgabiH97|021090 |
Gene name | |
Location | scaffold_10:1634563..1635294 |
Strand | + |
Gene length (bp) | 731 |
Transcript length (bp) | 513 |
Coding sequence length (bp) | 513 |
Protein length (aa) | 171 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF12296 | HsbA | Hydrophobic surface binding protein A | 1.1E-09 | 27 | 139 |
Localizations | Signals | Cytoplasm | Nucleus | Extracellular | Cell membrane | Mitochondrion | Plastid | Endoplasmic reticulum | Lysosome vacuole | Golgi apparatus | Peroxisome |
---|---|---|---|---|---|---|---|---|---|---|---|
Extracellular | Signal peptide | 0.0814 | 0.0439 | 0.9488 | 0.0747 | 0.0314 | 0.0051 | 0.1936 | 0.1278 | 0.0853 | 0.0012 |
SignalP signal predicted | Location | Score |
---|---|---|
Yes | 1 - 25 | 0.999728 |
Expression values
Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
---|---|---|---|---|
Casing | Casing mycelium | 385.60 | 229.69 | 541.51 |
Initials | Initials knots | 1198.46 | 646.72 | 1750.21 |
Pileal_Stipeal_center | Stage I stipe center | 1238.57 | 687.28 | 1789.86 |
Pileal_Stipeal_shell | Stage I stipe shell | 2570.05 | 1246.76 | 3893.34 |
DIF_stipe_center | Stage II stipe center | 253.92 | 150.99 | 356.86 |
DIF_stipe_shell | Stage II stipe shell | 1202.42 | 642.13 | 1762.71 |
DIF_stipe_skin | Stage II stipe skin | 2082.33 | 947.74 | 3216.93 |
DIF_cap_skin | Stage II cap skin | 3891.83 | 1675.44 | 6108.21 |
DIF_cap_tissue | Stage II cap tissue | 2105.21 | 986.92 | 3223.50 |
DIF_gill_tissue | Stage II gill tissue | 1401.66 | 648.81 | 2154.50 |
YFB_stipe_center | Young fruiting body stipe center | 611.48 | 346.90 | 876.06 |
YFB_stipe_shell | Young fruiting body stipe shell | 1434.57 | 765.57 | 2103.57 |
YFB_stipe_skin | Young fruiting body stipe skin | 4904.47 | 1850.80 | 7958.15 |
YFB_cap_skin | Young fruiting body cap skin | 7707.17 | 2405.82 | 13008.50 |
YFB_cap_tissue | Young fruiting body cap tissue | 2593.23 | 1273.79 | 3912.68 |
YFB_gill_tissue | Young fruiting body gill tissue | 5937.84 | 1794.88 | 10080.80 |
YFB_veil | Young fruiting body veil | 4534.44 | 1886.83 | 7182.05 |
Differential expression
Label1 | Label2 | Q-value | Significant difference |
---|---|---|---|
Casing | DIF_gill_tissue | 0.000613 | yes |
Casing | YFB_stipe_center | 0.114271 | no |
Casing | YFB_stipe_shell | 0.000613 | yes |
Casing | YFB_stipe_skin | 0.000613 | yes |
Casing | YFB_cap_skin | 0.000613 | yes |
Casing | YFB_cap_tissue | 0.000613 | yes |
Casing | YFB_gill_tissue | 0.000613 | yes |
Casing | YFB_veil | 0.000613 | yes |
Casing | Initials | 0.000613 | yes |
Casing | Pileal_Stipeal_center | 0.000613 | yes |
Casing | Pileal_Stipeal_shell | 0.000613 | yes |
Casing | DIF_stipe_center | 0.145929 | no |
Casing | DIF_stipe_shell | 0.000613 | yes |
Casing | DIF_stipe_skin | 0.000613 | yes |
Casing | DIF_cap_skin | 0.000613 | yes |
Casing | DIF_cap_tissue | 0.000613 | yes |
DIF_gill_tissue | YFB_stipe_center | 0.009773 | yes |
DIF_gill_tissue | YFB_stipe_shell | 0.972063 | no |
DIF_gill_tissue | YFB_stipe_skin | 0.001625 | yes |
DIF_gill_tissue | YFB_cap_skin | 0.000613 | yes |
DIF_gill_tissue | YFB_cap_tissue | 0.082806 | no |
DIF_gill_tissue | YFB_gill_tissue | 0.000613 | yes |
DIF_gill_tissue | YFB_veil | 0.001140 | yes |
YFB_stipe_center | YFB_stipe_shell | 0.001625 | yes |
YFB_stipe_center | YFB_stipe_skin | 0.000613 | yes |
YFB_stipe_center | YFB_cap_skin | 0.000613 | yes |
YFB_stipe_center | YFB_cap_tissue | 0.000613 | yes |
YFB_stipe_center | YFB_gill_tissue | 0.000613 | yes |
YFB_stipe_center | YFB_veil | 0.000613 | yes |
YFB_stipe_shell | YFB_stipe_skin | 0.001625 | yes |
YFB_stipe_shell | YFB_cap_skin | 0.000613 | yes |
YFB_stipe_shell | YFB_cap_tissue | 0.073585 | no |
YFB_stipe_shell | YFB_gill_tissue | 0.000613 | yes |
YFB_stipe_shell | YFB_veil | 0.001140 | yes |
YFB_stipe_skin | YFB_cap_skin | 0.395814 | no |
YFB_stipe_skin | YFB_cap_tissue | 0.108233 | no |
YFB_stipe_skin | YFB_gill_tissue | 0.785993 | no |
YFB_stipe_skin | YFB_veil | 0.918175 | no |
YFB_cap_skin | YFB_cap_tissue | 0.004928 | yes |
YFB_cap_skin | YFB_gill_tissue | 0.699679 | no |
YFB_cap_skin | YFB_veil | 0.284348 | no |
YFB_cap_tissue | YFB_gill_tissue | 0.048626 | yes |
YFB_cap_tissue | YFB_veil | 0.163299 | no |
YFB_gill_tissue | YFB_veil | 0.660958 | no |
Initials | DIF_gill_tissue | 0.764972 | no |
Initials | YFB_stipe_center | 0.023153 | yes |
Initials | YFB_stipe_shell | 0.700039 | no |
Initials | YFB_stipe_skin | 0.000613 | yes |
Initials | YFB_cap_skin | 0.000613 | yes |
Initials | YFB_cap_tissue | 0.013782 | yes |
Initials | YFB_gill_tissue | 0.000613 | yes |
Initials | YFB_veil | 0.000613 | yes |
Initials | Pileal_Stipeal_center | 0.956593 | no |
Initials | Pileal_Stipeal_shell | 0.016669 | yes |
Initials | DIF_stipe_center | 0.000613 | yes |
Initials | DIF_stipe_shell | 0.995353 | no |
Initials | DIF_stipe_skin | 0.120821 | no |
Initials | DIF_cap_skin | 0.000613 | yes |
Initials | DIF_cap_tissue | 0.101705 | no |
Pileal_Stipeal_center | DIF_gill_tissue | 0.816205 | no |
Pileal_Stipeal_center | YFB_stipe_center | 0.012274 | yes |
Pileal_Stipeal_center | YFB_stipe_shell | 0.758119 | no |
Pileal_Stipeal_center | YFB_stipe_skin | 0.000613 | yes |
Pileal_Stipeal_center | YFB_cap_skin | 0.000613 | yes |
Pileal_Stipeal_center | YFB_cap_tissue | 0.016669 | yes |
Pileal_Stipeal_center | YFB_gill_tissue | 0.000613 | yes |
Pileal_Stipeal_center | YFB_veil | 0.001140 | yes |
Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.021056 | yes |
Pileal_Stipeal_center | DIF_stipe_center | 0.000613 | yes |
Pileal_Stipeal_center | DIF_stipe_shell | 0.960621 | no |
Pileal_Stipeal_center | DIF_stipe_skin | 0.142789 | no |
Pileal_Stipeal_center | DIF_cap_skin | 0.000613 | yes |
Pileal_Stipeal_center | DIF_cap_tissue | 0.119615 | no |
Pileal_Stipeal_shell | DIF_gill_tissue | 0.086585 | no |
Pileal_Stipeal_shell | YFB_stipe_center | 0.000613 | yes |
Pileal_Stipeal_shell | YFB_stipe_shell | 0.077161 | no |
Pileal_Stipeal_shell | YFB_stipe_skin | 0.102020 | no |
Pileal_Stipeal_shell | YFB_cap_skin | 0.006742 | yes |
Pileal_Stipeal_shell | YFB_cap_tissue | 0.989829 | no |
Pileal_Stipeal_shell | YFB_gill_tissue | 0.045487 | yes |
Pileal_Stipeal_shell | YFB_veil | 0.151656 | no |
Pileal_Stipeal_shell | DIF_stipe_center | 0.000613 | yes |
Pileal_Stipeal_shell | DIF_stipe_shell | 0.015819 | yes |
Pileal_Stipeal_shell | DIF_stipe_skin | 0.689189 | no |
Pileal_Stipeal_shell | DIF_cap_skin | 0.318159 | no |
Pileal_Stipeal_shell | DIF_cap_tissue | 0.701425 | no |
DIF_stipe_center | DIF_gill_tissue | 0.000613 | yes |
DIF_stipe_center | YFB_stipe_center | 0.000613 | yes |
DIF_stipe_center | YFB_stipe_shell | 0.000613 | yes |
DIF_stipe_center | YFB_stipe_skin | 0.000613 | yes |
DIF_stipe_center | YFB_cap_skin | 0.000613 | yes |
DIF_stipe_center | YFB_cap_tissue | 0.000613 | yes |
DIF_stipe_center | YFB_gill_tissue | 0.000613 | yes |
DIF_stipe_center | YFB_veil | 0.000613 | yes |
DIF_stipe_center | DIF_stipe_shell | 0.000613 | yes |
DIF_stipe_center | DIF_stipe_skin | 0.000613 | yes |
DIF_stipe_center | DIF_cap_skin | 0.000613 | yes |
DIF_stipe_center | DIF_cap_tissue | 0.000613 | yes |
DIF_stipe_shell | DIF_gill_tissue | 0.770257 | no |
DIF_stipe_shell | YFB_stipe_center | 0.024444 | yes |
DIF_stipe_shell | YFB_stipe_shell | 0.705986 | no |
DIF_stipe_shell | YFB_stipe_skin | 0.000613 | yes |
DIF_stipe_shell | YFB_cap_skin | 0.000613 | yes |
DIF_stipe_shell | YFB_cap_tissue | 0.016104 | yes |
DIF_stipe_shell | YFB_gill_tissue | 0.000613 | yes |
DIF_stipe_shell | YFB_veil | 0.000613 | yes |
DIF_stipe_shell | DIF_stipe_skin | 0.121717 | no |
DIF_stipe_shell | DIF_cap_skin | 0.000613 | yes |
DIF_stipe_shell | DIF_cap_tissue | 0.102673 | no |
DIF_stipe_skin | DIF_gill_tissue | 0.360863 | no |
DIF_stipe_skin | YFB_stipe_center | 0.000613 | yes |
DIF_stipe_skin | YFB_stipe_shell | 0.359938 | no |
DIF_stipe_skin | YFB_stipe_skin | 0.024187 | yes |
DIF_stipe_skin | YFB_cap_skin | 0.002525 | yes |
DIF_stipe_skin | YFB_cap_tissue | 0.670634 | no |
DIF_stipe_skin | YFB_gill_tissue | 0.011350 | yes |
DIF_stipe_skin | YFB_veil | 0.043121 | yes |
DIF_stipe_skin | DIF_cap_skin | 0.107449 | no |
DIF_stipe_skin | DIF_cap_tissue | 0.988371 | no |
DIF_cap_skin | DIF_gill_tissue | 0.001625 | yes |
DIF_cap_skin | YFB_stipe_center | 0.000613 | yes |
DIF_cap_skin | YFB_stipe_shell | 0.002084 | yes |
DIF_cap_skin | YFB_stipe_skin | 0.692116 | no |
DIF_cap_skin | YFB_cap_skin | 0.123057 | no |
DIF_cap_skin | YFB_cap_tissue | 0.332902 | no |
DIF_cap_skin | YFB_gill_tissue | 0.403699 | no |
DIF_cap_skin | YFB_veil | 0.812044 | no |
DIF_cap_skin | DIF_cap_tissue | 0.102187 | no |
DIF_cap_tissue | DIF_gill_tissue | 0.327207 | no |
DIF_cap_tissue | YFB_stipe_center | 0.000613 | yes |
DIF_cap_tissue | YFB_stipe_shell | 0.323063 | no |
DIF_cap_tissue | YFB_stipe_skin | 0.022631 | yes |
DIF_cap_tissue | YFB_cap_skin | 0.002525 | yes |
DIF_cap_tissue | YFB_cap_tissue | 0.685022 | no |
DIF_cap_tissue | YFB_gill_tissue | 0.012577 | yes |
DIF_cap_tissue | YFB_veil | 0.040279 | yes |
Orthofinder run ID | 1 |
Orthogroup | 12117 |
Change Orthofinder run |
Species | Protein ID |
---|---|
Agaricus bisporus var bisporus H39 | AgabiH39|021090 |
Agaricus bisporus var bisporus H97 | AgabiH97|021090 (this protein) |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >AgabiH97|021090 MRFFTTLTAIIALATLSIGAPLTSRDVINDITEARQVVANLRGHLGGSGFNVIALANDDLAMTTILDRITKDASD VNAFNEADATEIISRTSQLASEVETTTAALIAKKDSVQGIFRNAVAQGLQVIINHAKAAGDAVVKDCPADKKAEA NRVYLRIANSLSQAEKTFAS* |
Coding | >AgabiH97|021090 ATGCGTTTCTTCACCACGTTGACCGCTATTATCGCATTGGCAACCCTTTCTATTGGCGCCCCACTTACAAGCCGC GACGTGATTAATGATATCACTGAGGCTAGGCAGGTTGTTGCAAATTTACGTGGACACCTGGGTGGCTCCGGCTTC AATGTGATAGCTTTGGCGAACGACGATTTGGCGATGACTACGATTCTTGACCGAATTACCAAAGATGCTTCGGAT GTCAATGCGTTTAATGAGGCGGATGCTACCGAGATCATTTCCAGGACCAGTCAATTGGCTAGTGAAGTAGAAACC ACTACTGCGGCTCTCATTGCAAAGAAGGATTCTGTACAGGGTATCTTCCGCAATGCCGTTGCGCAGGGTTTGCAG GTCATTATCAATCACGCGAAAGCGGCAGGGGATGCAGTCGTTAAAGACTGTCCGGCCGACAAGAAAGCGGAGGCT AACAGGGTGTATCTCCGGATAGCAAACTCTTTATCCCAGGCGGAAAAAACCTTCGCTTCTTAA |
Transcript | >AgabiH97|021090 ATGCGTTTCTTCACCACGTTGACCGCTATTATCGCATTGGCAACCCTTTCTATTGGCGCCCCACTTACAAGCCGC GACGTGATTAATGATATCACTGAGGCTAGGCAGGTTGTTGCAAATTTACGTGGACACCTGGGTGGCTCCGGCTTC AATGTGATAGCTTTGGCGAACGACGATTTGGCGATGACTACGATTCTTGACCGAATTACCAAAGATGCTTCGGAT GTCAATGCGTTTAATGAGGCGGATGCTACCGAGATCATTTCCAGGACCAGTCAATTGGCTAGTGAAGTAGAAACC ACTACTGCGGCTCTCATTGCAAAGAAGGATTCTGTACAGGGTATCTTCCGCAATGCCGTTGCGCAGGGTTTGCAG GTCATTATCAATCACGCGAAAGCGGCAGGGGATGCAGTCGTTAAAGACTGTCCGGCCGACAAGAAAGCGGAGGCT AACAGGGTGTATCTCCGGATAGCAAACTCTTTATCCCAGGCGGAAAAAACCTTCGCTTCTTAA |
Gene | >AgabiH97|021090 ATGCGTTTCTTCACCACGTTGACCGCTATTATCGCATTGGCAACCCTTTCTATTGGCGCCCCACTTACAAGCCGC GACGTGATTAATGATATCACTGAGGCTAGGCAGGTTGTTGCAAATTTACGTGGACACCTGGGTGGCTCCGGCTTC AATGTGATAGTAAGTCGGTTCCAGCCGGACCGCACAGGAAACTTAATAGATTTCATGACCTCCTCTCGGCAGGCT TTGGCGAACGACGATTTGGCGATGACTACGATTCTTGACCGAATTACCAAAGATGCTTCGGTATGTAGGTTCTCG TGTTTTAATTTTCGTAGTGTCTGGAATTTGGAAAGGCTGAAGGCTGTGTAATCCATTGGTTCTTTTTCTATTCAG GATGTCAATGCGTTTAATGAGGCGGATGCTACCGAGATCATTTCCAGGACCAGTCAATTGGCTAGTGAAGTAGAA ACCACTACTGCGGCTCTCATTGCAAAGAAGGATTCTGTACAGGGTATCTTCCGCAATGCCGTTGCGCAGGGTTTG CAGGTCATTATCAATCACGCGAAAGCGGCAGGGGATGCAGTCGTTAAAGACTGTCCGGTAAGGACATTTATTCCA TTTGAAATTTCCTCGATGAAATTTAATTGATGCGGATCGTCTTGAAGGCCGACAAGAAAGCGGAGGCTAACAGGG TGTATCTCCGGATAGCAAACTCTTTATCCCAGGCGGAAAAAACCTTCGCTTCTTAA |