Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|021090
Gene name
Locationscaffold_10:1634563..1635294
Strand+
Gene length (bp)731
Transcript length (bp)513
Coding sequence length (bp)513
Protein length (aa) 171

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12296 HsbA Hydrophobic surface binding protein A 1.1E-09 27 139

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0814 0.0439 0.9488 0.0747 0.0314 0.0051 0.1936 0.1278 0.0853 0.0012

SignalP

SignalP signal predicted Location Score
Yes 1 - 25 0.999728

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 385.60 229.69 541.51
Initials Initials knots 1198.46 646.72 1750.21
Pileal_Stipeal_center Stage I stipe center 1238.57 687.28 1789.86
Pileal_Stipeal_shell Stage I stipe shell 2570.05 1246.76 3893.34
DIF_stipe_center Stage II stipe center 253.92 150.99 356.86
DIF_stipe_shell Stage II stipe shell 1202.42 642.13 1762.71
DIF_stipe_skin Stage II stipe skin 2082.33 947.74 3216.93
DIF_cap_skin Stage II cap skin 3891.83 1675.44 6108.21
DIF_cap_tissue Stage II cap tissue 2105.21 986.92 3223.50
DIF_gill_tissue Stage II gill tissue 1401.66 648.81 2154.50
YFB_stipe_center Young fruiting body stipe center 611.48 346.90 876.06
YFB_stipe_shell Young fruiting body stipe shell 1434.57 765.57 2103.57
YFB_stipe_skin Young fruiting body stipe skin 4904.47 1850.80 7958.15
YFB_cap_skin Young fruiting body cap skin 7707.17 2405.82 13008.50
YFB_cap_tissue Young fruiting body cap tissue 2593.23 1273.79 3912.68
YFB_gill_tissue Young fruiting body gill tissue 5937.84 1794.88 10080.80
YFB_veil Young fruiting body veil 4534.44 1886.83 7182.05

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.114271 no
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.000613 yes
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.000613 yes
Casing Pileal_Stipeal_center 0.000613 yes
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.145929 no
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.000613 yes
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.009773 yes
DIF_gill_tissue YFB_stipe_shell 0.972063 no
DIF_gill_tissue YFB_stipe_skin 0.001625 yes
DIF_gill_tissue YFB_cap_skin 0.000613 yes
DIF_gill_tissue YFB_cap_tissue 0.082806 no
DIF_gill_tissue YFB_gill_tissue 0.000613 yes
DIF_gill_tissue YFB_veil 0.001140 yes
YFB_stipe_center YFB_stipe_shell 0.001625 yes
YFB_stipe_center YFB_stipe_skin 0.000613 yes
YFB_stipe_center YFB_cap_skin 0.000613 yes
YFB_stipe_center YFB_cap_tissue 0.000613 yes
YFB_stipe_center YFB_gill_tissue 0.000613 yes
YFB_stipe_center YFB_veil 0.000613 yes
YFB_stipe_shell YFB_stipe_skin 0.001625 yes
YFB_stipe_shell YFB_cap_skin 0.000613 yes
YFB_stipe_shell YFB_cap_tissue 0.073585 no
YFB_stipe_shell YFB_gill_tissue 0.000613 yes
YFB_stipe_shell YFB_veil 0.001140 yes
YFB_stipe_skin YFB_cap_skin 0.395814 no
YFB_stipe_skin YFB_cap_tissue 0.108233 no
YFB_stipe_skin YFB_gill_tissue 0.785993 no
YFB_stipe_skin YFB_veil 0.918175 no
YFB_cap_skin YFB_cap_tissue 0.004928 yes
YFB_cap_skin YFB_gill_tissue 0.699679 no
YFB_cap_skin YFB_veil 0.284348 no
YFB_cap_tissue YFB_gill_tissue 0.048626 yes
YFB_cap_tissue YFB_veil 0.163299 no
YFB_gill_tissue YFB_veil 0.660958 no
Initials DIF_gill_tissue 0.764972 no
Initials YFB_stipe_center 0.023153 yes
Initials YFB_stipe_shell 0.700039 no
Initials YFB_stipe_skin 0.000613 yes
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.013782 yes
Initials YFB_gill_tissue 0.000613 yes
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.956593 no
Initials Pileal_Stipeal_shell 0.016669 yes
Initials DIF_stipe_center 0.000613 yes
Initials DIF_stipe_shell 0.995353 no
Initials DIF_stipe_skin 0.120821 no
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.101705 no
Pileal_Stipeal_center DIF_gill_tissue 0.816205 no
Pileal_Stipeal_center YFB_stipe_center 0.012274 yes
Pileal_Stipeal_center YFB_stipe_shell 0.758119 no
Pileal_Stipeal_center YFB_stipe_skin 0.000613 yes
Pileal_Stipeal_center YFB_cap_skin 0.000613 yes
Pileal_Stipeal_center YFB_cap_tissue 0.016669 yes
Pileal_Stipeal_center YFB_gill_tissue 0.000613 yes
Pileal_Stipeal_center YFB_veil 0.001140 yes
Pileal_Stipeal_center Pileal_Stipeal_shell 0.021056 yes
Pileal_Stipeal_center DIF_stipe_center 0.000613 yes
Pileal_Stipeal_center DIF_stipe_shell 0.960621 no
Pileal_Stipeal_center DIF_stipe_skin 0.142789 no
Pileal_Stipeal_center DIF_cap_skin 0.000613 yes
Pileal_Stipeal_center DIF_cap_tissue 0.119615 no
Pileal_Stipeal_shell DIF_gill_tissue 0.086585 no
Pileal_Stipeal_shell YFB_stipe_center 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.077161 no
Pileal_Stipeal_shell YFB_stipe_skin 0.102020 no
Pileal_Stipeal_shell YFB_cap_skin 0.006742 yes
Pileal_Stipeal_shell YFB_cap_tissue 0.989829 no
Pileal_Stipeal_shell YFB_gill_tissue 0.045487 yes
Pileal_Stipeal_shell YFB_veil 0.151656 no
Pileal_Stipeal_shell DIF_stipe_center 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_shell 0.015819 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.689189 no
Pileal_Stipeal_shell DIF_cap_skin 0.318159 no
Pileal_Stipeal_shell DIF_cap_tissue 0.701425 no
DIF_stipe_center DIF_gill_tissue 0.000613 yes
DIF_stipe_center YFB_stipe_center 0.000613 yes
DIF_stipe_center YFB_stipe_shell 0.000613 yes
DIF_stipe_center YFB_stipe_skin 0.000613 yes
DIF_stipe_center YFB_cap_skin 0.000613 yes
DIF_stipe_center YFB_cap_tissue 0.000613 yes
DIF_stipe_center YFB_gill_tissue 0.000613 yes
DIF_stipe_center YFB_veil 0.000613 yes
DIF_stipe_center DIF_stipe_shell 0.000613 yes
DIF_stipe_center DIF_stipe_skin 0.000613 yes
DIF_stipe_center DIF_cap_skin 0.000613 yes
DIF_stipe_center DIF_cap_tissue 0.000613 yes
DIF_stipe_shell DIF_gill_tissue 0.770257 no
DIF_stipe_shell YFB_stipe_center 0.024444 yes
DIF_stipe_shell YFB_stipe_shell 0.705986 no
DIF_stipe_shell YFB_stipe_skin 0.000613 yes
DIF_stipe_shell YFB_cap_skin 0.000613 yes
DIF_stipe_shell YFB_cap_tissue 0.016104 yes
DIF_stipe_shell YFB_gill_tissue 0.000613 yes
DIF_stipe_shell YFB_veil 0.000613 yes
DIF_stipe_shell DIF_stipe_skin 0.121717 no
DIF_stipe_shell DIF_cap_skin 0.000613 yes
DIF_stipe_shell DIF_cap_tissue 0.102673 no
DIF_stipe_skin DIF_gill_tissue 0.360863 no
DIF_stipe_skin YFB_stipe_center 0.000613 yes
DIF_stipe_skin YFB_stipe_shell 0.359938 no
DIF_stipe_skin YFB_stipe_skin 0.024187 yes
DIF_stipe_skin YFB_cap_skin 0.002525 yes
DIF_stipe_skin YFB_cap_tissue 0.670634 no
DIF_stipe_skin YFB_gill_tissue 0.011350 yes
DIF_stipe_skin YFB_veil 0.043121 yes
DIF_stipe_skin DIF_cap_skin 0.107449 no
DIF_stipe_skin DIF_cap_tissue 0.988371 no
DIF_cap_skin DIF_gill_tissue 0.001625 yes
DIF_cap_skin YFB_stipe_center 0.000613 yes
DIF_cap_skin YFB_stipe_shell 0.002084 yes
DIF_cap_skin YFB_stipe_skin 0.692116 no
DIF_cap_skin YFB_cap_skin 0.123057 no
DIF_cap_skin YFB_cap_tissue 0.332902 no
DIF_cap_skin YFB_gill_tissue 0.403699 no
DIF_cap_skin YFB_veil 0.812044 no
DIF_cap_skin DIF_cap_tissue 0.102187 no
DIF_cap_tissue DIF_gill_tissue 0.327207 no
DIF_cap_tissue YFB_stipe_center 0.000613 yes
DIF_cap_tissue YFB_stipe_shell 0.323063 no
DIF_cap_tissue YFB_stipe_skin 0.022631 yes
DIF_cap_tissue YFB_cap_skin 0.002525 yes
DIF_cap_tissue YFB_cap_tissue 0.685022 no
DIF_cap_tissue YFB_gill_tissue 0.012577 yes
DIF_cap_tissue YFB_veil 0.040279 yes

Orthologs

Orthofinder run ID1
Orthogroup12117
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|021090
Agaricus bisporus var bisporus H97 AgabiH97|021090 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|021090
MRFFTTLTAIIALATLSIGAPLTSRDVINDITEARQVVANLRGHLGGSGFNVIALANDDLAMTTILDRITKDASD
VNAFNEADATEIISRTSQLASEVETTTAALIAKKDSVQGIFRNAVAQGLQVIINHAKAAGDAVVKDCPADKKAEA
NRVYLRIANSLSQAEKTFAS*
Coding >AgabiH97|021090
ATGCGTTTCTTCACCACGTTGACCGCTATTATCGCATTGGCAACCCTTTCTATTGGCGCCCCACTTACAAGCCGC
GACGTGATTAATGATATCACTGAGGCTAGGCAGGTTGTTGCAAATTTACGTGGACACCTGGGTGGCTCCGGCTTC
AATGTGATAGCTTTGGCGAACGACGATTTGGCGATGACTACGATTCTTGACCGAATTACCAAAGATGCTTCGGAT
GTCAATGCGTTTAATGAGGCGGATGCTACCGAGATCATTTCCAGGACCAGTCAATTGGCTAGTGAAGTAGAAACC
ACTACTGCGGCTCTCATTGCAAAGAAGGATTCTGTACAGGGTATCTTCCGCAATGCCGTTGCGCAGGGTTTGCAG
GTCATTATCAATCACGCGAAAGCGGCAGGGGATGCAGTCGTTAAAGACTGTCCGGCCGACAAGAAAGCGGAGGCT
AACAGGGTGTATCTCCGGATAGCAAACTCTTTATCCCAGGCGGAAAAAACCTTCGCTTCTTAA
Transcript >AgabiH97|021090
ATGCGTTTCTTCACCACGTTGACCGCTATTATCGCATTGGCAACCCTTTCTATTGGCGCCCCACTTACAAGCCGC
GACGTGATTAATGATATCACTGAGGCTAGGCAGGTTGTTGCAAATTTACGTGGACACCTGGGTGGCTCCGGCTTC
AATGTGATAGCTTTGGCGAACGACGATTTGGCGATGACTACGATTCTTGACCGAATTACCAAAGATGCTTCGGAT
GTCAATGCGTTTAATGAGGCGGATGCTACCGAGATCATTTCCAGGACCAGTCAATTGGCTAGTGAAGTAGAAACC
ACTACTGCGGCTCTCATTGCAAAGAAGGATTCTGTACAGGGTATCTTCCGCAATGCCGTTGCGCAGGGTTTGCAG
GTCATTATCAATCACGCGAAAGCGGCAGGGGATGCAGTCGTTAAAGACTGTCCGGCCGACAAGAAAGCGGAGGCT
AACAGGGTGTATCTCCGGATAGCAAACTCTTTATCCCAGGCGGAAAAAACCTTCGCTTCTTAA
Gene >AgabiH97|021090
ATGCGTTTCTTCACCACGTTGACCGCTATTATCGCATTGGCAACCCTTTCTATTGGCGCCCCACTTACAAGCCGC
GACGTGATTAATGATATCACTGAGGCTAGGCAGGTTGTTGCAAATTTACGTGGACACCTGGGTGGCTCCGGCTTC
AATGTGATAGTAAGTCGGTTCCAGCCGGACCGCACAGGAAACTTAATAGATTTCATGACCTCCTCTCGGCAGGCT
TTGGCGAACGACGATTTGGCGATGACTACGATTCTTGACCGAATTACCAAAGATGCTTCGGTATGTAGGTTCTCG
TGTTTTAATTTTCGTAGTGTCTGGAATTTGGAAAGGCTGAAGGCTGTGTAATCCATTGGTTCTTTTTCTATTCAG
GATGTCAATGCGTTTAATGAGGCGGATGCTACCGAGATCATTTCCAGGACCAGTCAATTGGCTAGTGAAGTAGAA
ACCACTACTGCGGCTCTCATTGCAAAGAAGGATTCTGTACAGGGTATCTTCCGCAATGCCGTTGCGCAGGGTTTG
CAGGTCATTATCAATCACGCGAAAGCGGCAGGGGATGCAGTCGTTAAAGACTGTCCGGTAAGGACATTTATTCCA
TTTGAAATTTCCTCGATGAAATTTAATTGATGCGGATCGTCTTGAAGGCCGACAAGAAAGCGGAGGCTAACAGGG
TGTATCTCCGGATAGCAAACTCTTTATCCCAGGCGGAAAAAACCTTCGCTTCTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail