Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|020990
Gene name
Locationscaffold_10:1605859..1607059
Strand-
Gene length (bp)1200
Transcript length (bp)1200
Coding sequence length (bp)1200
Protein length (aa) 400

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 9.4E-08 60 149

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.7374 0.5832 0.342 0.0859 0.0882 0.0428 0.1161 0.018 0.0909 0.0074

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup9669
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|318300
Agaricus bisporus var bisporus H39 AgabiH39|397900
Agaricus bisporus var bisporus H97 AgabiH97|020980
Agaricus bisporus var bisporus H97 AgabiH97|020990 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|020990
MQHKDSSLTAWDVSGSSQPLPPLPTAPSELAKENAIRMTLSLQATALIESTLPDYMIREDFNGPGDLWDKMKLNY
GVRGPTFVYERLQALINFKVQDTQDPSGQIAEFVAICSQITATGATLHDSLQTMMLLSALPARMESTIGIILAPA
TKVADLTIEKARGIITAAWRNPQNLAAARFKPSGQAPRWQNATPGTSGQNQQQQQRPHGQQQQRPQGQQQRQQAP
QGAKPDDDKKRKRTRGKGKGKGKGKAAAVEASPPDYTAASVIAFPTIAIPPGIETQPYDPRSPSLSAPTTRSLVH
RIRNEKAAITPPTPLIGELSHSTSQSSPNEISVHSPLHMEIIMLNIHDGNKWIDDWRHDVDYQNSIESNPNDLES
VDPSADGTWLDDGSREQSISVDCD*
Coding >AgabiH97|020990
ATGCAACATAAGGACTCCTCCCTGACCGCATGGGATGTTAGCGGTAGCTCTCAGCCGCTCCCCCCCTTGCCTACA
GCTCCTTCTGAGCTAGCTAAGGAAAATGCTATCAGGATGACTCTCAGCCTGCAGGCAACTGCATTGATCGAGTCC
ACTCTCCCGGATTACATGATCCGAGAGGATTTCAACGGCCCTGGAGATCTCTGGGACAAAATGAAGTTGAATTAC
GGAGTCCGAGGACCGACTTTCGTCTACGAAAGGCTCCAGGCCCTCATAAATTTTAAGGTTCAGGACACCCAGGAT
CCATCTGGACAAATCGCTGAGTTCGTCGCGATCTGTTCACAGATCACTGCCACTGGGGCGACTCTTCATGACTCG
CTCCAGACCATGATGCTCCTTTCCGCTCTTCCGGCTCGTATGGAATCTACGATCGGAATCATCCTCGCTCCAGCC
ACGAAGGTAGCTGATCTCACTATTGAGAAAGCGAGAGGTATTATCACCGCGGCTTGGCGAAACCCTCAGAATCTC
GCCGCCGCCAGGTTTAAGCCGTCCGGACAGGCTCCGCGATGGCAGAATGCCACGCCTGGAACATCCGGGCAAAAT
CAGCAGCAGCAGCAGCGTCCTCATGGACAGCAGCAGCAACGGCCGCAAGGCCAGCAGCAGAGGCAGCAAGCTCCG
CAAGGGGCTAAACCTGATGATGATAAGAAGCGTAAGAGGACTCGTGGCAAAGGCAAGGGCAAGGGAAAAGGAAAA
GCCGCAGCGGTCGAGGCCTCGCCTCCCGATTACACTGCAGCTTCTGTGATTGCGTTCCCTACGATCGCGATTCCT
CCGGGTATTGAAACCCAACCCTACGACCCTCGCTCACCTTCTCTCTCTGCACCGACCACACGGTCTTTGGTGCAT
CGTATCCGAAATGAGAAAGCAGCTATCACGCCGCCGACTCCCTTGATTGGTGAGTTGTCTCATTCTACATCACAA
TCATCTCCTAACGAAATTTCTGTGCACTCTCCCCTTCACATGGAAATCATCATGTTAAACATTCATGATGGAAAC
AAATGGATTGATGATTGGCGTCACGACGTCGATTACCAAAACTCGATCGAATCTAACCCGAATGATCTCGAATCG
GTTGATCCATCTGCTGATGGAACCTGGCTCGATGATGGATCTCGGGAACAATCAATCTCGGTTGATTGCGATTGA
Transcript >AgabiH97|020990
ATGCAACATAAGGACTCCTCCCTGACCGCATGGGATGTTAGCGGTAGCTCTCAGCCGCTCCCCCCCTTGCCTACA
GCTCCTTCTGAGCTAGCTAAGGAAAATGCTATCAGGATGACTCTCAGCCTGCAGGCAACTGCATTGATCGAGTCC
ACTCTCCCGGATTACATGATCCGAGAGGATTTCAACGGCCCTGGAGATCTCTGGGACAAAATGAAGTTGAATTAC
GGAGTCCGAGGACCGACTTTCGTCTACGAAAGGCTCCAGGCCCTCATAAATTTTAAGGTTCAGGACACCCAGGAT
CCATCTGGACAAATCGCTGAGTTCGTCGCGATCTGTTCACAGATCACTGCCACTGGGGCGACTCTTCATGACTCG
CTCCAGACCATGATGCTCCTTTCCGCTCTTCCGGCTCGTATGGAATCTACGATCGGAATCATCCTCGCTCCAGCC
ACGAAGGTAGCTGATCTCACTATTGAGAAAGCGAGAGGTATTATCACCGCGGCTTGGCGAAACCCTCAGAATCTC
GCCGCCGCCAGGTTTAAGCCGTCCGGACAGGCTCCGCGATGGCAGAATGCCACGCCTGGAACATCCGGGCAAAAT
CAGCAGCAGCAGCAGCGTCCTCATGGACAGCAGCAGCAACGGCCGCAAGGCCAGCAGCAGAGGCAGCAAGCTCCG
CAAGGGGCTAAACCTGATGATGATAAGAAGCGTAAGAGGACTCGTGGCAAAGGCAAGGGCAAGGGAAAAGGAAAA
GCCGCAGCGGTCGAGGCCTCGCCTCCCGATTACACTGCAGCTTCTGTGATTGCGTTCCCTACGATCGCGATTCCT
CCGGGTATTGAAACCCAACCCTACGACCCTCGCTCACCTTCTCTCTCTGCACCGACCACACGGTCTTTGGTGCAT
CGTATCCGAAATGAGAAAGCAGCTATCACGCCGCCGACTCCCTTGATTGGTGAGTTGTCTCATTCTACATCACAA
TCATCTCCTAACGAAATTTCTGTGCACTCTCCCCTTCACATGGAAATCATCATGTTAAACATTCATGATGGAAAC
AAATGGATTGATGATTGGCGTCACGACGTCGATTACCAAAACTCGATCGAATCTAACCCGAATGATCTCGAATCG
GTTGATCCATCTGCTGATGGAACCTGGCTCGATGATGGATCTCGGGAACAATCAATCTCGGTTGATTGCGATTGA
Gene >AgabiH97|020990
ATGCAACATAAGGACTCCTCCCTGACCGCATGGGATGTTAGCGGTAGCTCTCAGCCGCTCCCCCCCTTGCCTACA
GCTCCTTCTGAGCTAGCTAAGGAAAATGCTATCAGGATGACTCTCAGCCTGCAGGCAACTGCATTGATCGAGTCC
ACTCTCCCGGATTACATGATCCGAGAGGATTTCAACGGCCCTGGAGATCTCTGGGACAAAATGAAGTTGAATTAC
GGAGTCCGAGGACCGACTTTCGTCTACGAAAGGCTCCAGGCCCTCATAAATTTTAAGGTTCAGGACACCCAGGAT
CCATCTGGACAAATCGCTGAGTTCGTCGCGATCTGTTCACAGATCACTGCCACTGGGGCGACTCTTCATGACTCG
CTCCAGACCATGATGCTCCTTTCCGCTCTTCCGGCTCGTATGGAATCTACGATCGGAATCATCCTCGCTCCAGCC
ACGAAGGTAGCTGATCTCACTATTGAGAAAGCGAGAGGTATTATCACCGCGGCTTGGCGAAACCCTCAGAATCTC
GCCGCCGCCAGGTTTAAGCCGTCCGGACAGGCTCCGCGATGGCAGAATGCCACGCCTGGAACATCCGGGCAAAAT
CAGCAGCAGCAGCAGCGTCCTCATGGACAGCAGCAGCAACGGCCGCAAGGCCAGCAGCAGAGGCAGCAAGCTCCG
CAAGGGGCTAAACCTGATGATGATAAGAAGCGTAAGAGGACTCGTGGCAAAGGCAAGGGCAAGGGAAAAGGAAAA
GCCGCAGCGGTCGAGGCCTCGCCTCCCGATTACACTGCAGCTTCTGTGATTGCGTTCCCTACGATCGCGATTCCT
CCGGGTATTGAAACCCAACCCTACGACCCTCGCTCACCTTCTCTCTCTGCACCGACCACACGGTCTTTGGTGCAT
CGTATCCGAAATGAGAAAGCAGCTATCACGCCGCCGACTCCCTTGATTGGTGAGTTGTCTCATTCTACATCACAA
TCATCTCCTAACGAAATTTCTGTGCACTCTCCCCTTCACATGGAAATCATCATGTTAAACATTCATGATGGAAAC
AAATGGATTGATGATTGGCGTCACGACGTCGATTACCAAAACTCGATCGAATCTAACCCGAATGATCTCGAATCG
GTTGATCCATCTGCTGATGGAACCTGGCTCGATGATGGATCTCGGGAACAATCAATCTCGGTTGATTGCGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail