Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|020790
Gene name
Locationscaffold_10:1545498..1549794
Strand+
Gene length (bp)4296
Transcript length (bp)2607
Coding sequence length (bp)2607
Protein length (aa) 869

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00343 Phosphorylase Carbohydrate phosphorylase 5.2E-304 146 862

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5MIB6|PYGB_SHEEP Glycogen phosphorylase, brain form OS=Ovis aries GN=PYGB PE=2 SV=3 49 866 0.0E+00
sp|Q0VCM4|PYGL_BOVIN Glycogen phosphorylase, liver form OS=Bos taurus GN=PYGL PE=2 SV=1 49 867 0.0E+00
sp|P11216|PYGB_HUMAN Glycogen phosphorylase, brain form OS=Homo sapiens GN=PYGB PE=1 SV=5 49 865 0.0E+00
sp|Q9ET01|PYGL_MOUSE Glycogen phosphorylase, liver form OS=Mus musculus GN=Pygl PE=1 SV=4 49 863 0.0E+00
sp|Q5MIB5|PYGL_SHEEP Glycogen phosphorylase, liver form OS=Ovis aries GN=PYGL PE=2 SV=3 49 867 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5MIB6|PYGB_SHEEP Glycogen phosphorylase, brain form OS=Ovis aries GN=PYGB PE=2 SV=3 49 866 0.0E+00
sp|Q0VCM4|PYGL_BOVIN Glycogen phosphorylase, liver form OS=Bos taurus GN=PYGL PE=2 SV=1 49 867 0.0E+00
sp|P11216|PYGB_HUMAN Glycogen phosphorylase, brain form OS=Homo sapiens GN=PYGB PE=1 SV=5 49 865 0.0E+00
sp|Q9ET01|PYGL_MOUSE Glycogen phosphorylase, liver form OS=Mus musculus GN=Pygl PE=1 SV=4 49 863 0.0E+00
sp|Q5MIB5|PYGL_SHEEP Glycogen phosphorylase, liver form OS=Ovis aries GN=PYGL PE=2 SV=3 49 867 0.0E+00
sp|Q5R5M6|PYGB_PONAB Glycogen phosphorylase, brain form OS=Pongo abelii GN=PYGB PE=2 SV=3 49 865 0.0E+00
sp|P73511|PHSG_SYNY3 Glycogen phosphorylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=glgP PE=3 SV=1 84 863 0.0E+00
sp|Q3B7M9|PYGB_BOVIN Glycogen phosphorylase, brain form OS=Bos taurus GN=PYGB PE=2 SV=3 49 866 0.0E+00
sp|P06737|PYGL_HUMAN Glycogen phosphorylase, liver form OS=Homo sapiens GN=PYGL PE=1 SV=4 49 863 0.0E+00
sp|Q00766|PHS1_DICDI Glycogen phosphorylase 1 OS=Dictyostelium discoideum GN=glpV PE=1 SV=3 16 867 0.0E+00
sp|Q8CI94|PYGB_MOUSE Glycogen phosphorylase, brain form OS=Mus musculus GN=Pygb PE=1 SV=3 42 865 0.0E+00
sp|P53534|PYGB_RAT Glycogen phosphorylase, brain form (Fragment) OS=Rattus norvegicus GN=Pygb PE=1 SV=3 42 865 0.0E+00
sp|P0AC87|PHSG_SHIFL Glycogen phosphorylase OS=Shigella flexneri GN=glgP PE=3 SV=1 87 863 0.0E+00
sp|P0AC86|PHSG_ECOLI Glycogen phosphorylase OS=Escherichia coli (strain K12) GN=glgP PE=3 SV=1 87 863 0.0E+00
sp|P00490|PHSM_ECOLI Maltodextrin phosphorylase OS=Escherichia coli (strain K12) GN=malP PE=1 SV=7 111 860 0.0E+00
sp|P45180|PHSG_HAEIN Glycogen phosphorylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=glgP PE=3 SV=1 91 863 0.0E+00
sp|Q9CN90|PHSG_PASMU Glycogen phosphorylase OS=Pasteurella multocida (strain Pm70) GN=glgP PE=3 SV=1 57 863 0.0E+00
sp|P39123|PHSG_BACSU Glycogen phosphorylase OS=Bacillus subtilis (strain 168) GN=glgP PE=2 SV=1 85 863 0.0E+00
sp|Q9PKE6|PHSG_CHLMU Glycogen phosphorylase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=glgP PE=3 SV=1 85 865 0.0E+00
sp|P06738|PHSG_YEAST Glycogen phosphorylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPH1 PE=1 SV=4 13 868 0.0E+00
sp|P34114|PHS2_DICDI Glycogen phosphorylase 2 OS=Dictyostelium discoideum GN=glpD PE=1 SV=2 55 864 0.0E+00
sp|Q9SD76|PHS2_ARATH Alpha-glucan phosphorylase 2, cytosolic OS=Arabidopsis thaliana GN=PHS2 PE=1 SV=1 56 867 0.0E+00
sp|P32811|PHSH_SOLTU Alpha-glucan phosphorylase, H isozyme OS=Solanum tuberosum PE=1 SV=1 53 867 0.0E+00
sp|P53537|PHSH_VICFA Alpha-glucan phosphorylase, H isozyme OS=Vicia faba PE=2 SV=1 59 867 0.0E+00
sp|Q9LKJ3|PHSH_WHEAT Alpha-glucan phosphorylase, H isozyme OS=Triticum aestivum PE=2 SV=1 55 867 0.0E+00
sp|Q9XTL9|PYG_DROME Glycogen phosphorylase OS=Drosophila melanogaster GN=GlyP PE=2 SV=2 47 865 0.0E+00
sp|P79334|PYGM_BOVIN Glycogen phosphorylase, muscle form OS=Bos taurus GN=PYGM PE=1 SV=3 49 865 0.0E+00
sp|P11217|PYGM_HUMAN Glycogen phosphorylase, muscle form OS=Homo sapiens GN=PYGM PE=1 SV=6 49 865 0.0E+00
sp|O84250|PHSG_CHLTR Glycogen phosphorylase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=glgP PE=3 SV=1 100 864 0.0E+00
sp|Q8HXW4|PYGM_MACFA Glycogen phosphorylase, muscle form OS=Macaca fascicularis GN=PYGM PE=2 SV=3 49 865 0.0E+00
sp|P09812|PYGM_RAT Glycogen phosphorylase, muscle form OS=Rattus norvegicus GN=Pygm PE=1 SV=5 49 865 0.0E+00
sp|Q9Z8N1|PHSG_CHLPN Glycogen phosphorylase OS=Chlamydia pneumoniae GN=glgP PE=3 SV=1 85 868 0.0E+00
sp|P00489|PYGM_RABIT Glycogen phosphorylase, muscle form OS=Oryctolagus cuniculus GN=PYGM PE=1 SV=3 49 865 0.0E+00
sp|Q9WUB3|PYGM_MOUSE Glycogen phosphorylase, muscle form OS=Mus musculus GN=Pygm PE=1 SV=3 49 865 0.0E+00
sp|P09811|PYGL_RAT Glycogen phosphorylase, liver form OS=Rattus norvegicus GN=Pygl PE=1 SV=5 49 865 0.0E+00
sp|O18751|PYGM_SHEEP Glycogen phosphorylase, muscle form OS=Ovis aries GN=PYGM PE=2 SV=3 49 865 0.0E+00
sp|P29849|PHSM_STRPN Maltodextrin phosphorylase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=malP PE=3 SV=2 113 862 3.0E-144
sp|Q9LIB2|PHS1_ARATH Alpha-glucan phosphorylase 1 OS=Arabidopsis thaliana GN=PHS1 PE=2 SV=1 12 447 6.0E-123
sp|P27598|PHSL_IPOBA Alpha-1,4 glucan phosphorylase L isozyme, chloroplastic/amyloplastic OS=Ipomoea batatas PE=2 SV=1 56 456 5.0E-122
sp|P53535|PHSL2_SOLTU Alpha-1,4 glucan phosphorylase L-2 isozyme, chloroplastic/amyloplastic OS=Solanum tuberosum GN=STP-1 PE=1 SV=1 56 443 3.0E-121
sp|P04045|PHSL1_SOLTU Alpha-1,4 glucan phosphorylase L-1 isozyme, chloroplastic/amyloplastic OS=Solanum tuberosum PE=1 SV=2 56 461 7.0E-119
sp|P53536|PHSL_VICFA Alpha-1,4 glucan phosphorylase L isozyme, chloroplastic/amyloplastic OS=Vicia faba GN=PHO1 PE=2 SV=2 56 461 2.0E-117
sp|Q9LIB2|PHS1_ARATH Alpha-glucan phosphorylase 1 OS=Arabidopsis thaliana GN=PHS1 PE=2 SV=1 465 865 1.0E-108
sp|P04045|PHSL1_SOLTU Alpha-1,4 glucan phosphorylase L-1 isozyme, chloroplastic/amyloplastic OS=Solanum tuberosum PE=1 SV=2 465 868 1.0E-101
sp|P27598|PHSL_IPOBA Alpha-1,4 glucan phosphorylase L isozyme, chloroplastic/amyloplastic OS=Ipomoea batatas PE=2 SV=1 465 863 6.0E-101
sp|P53535|PHSL2_SOLTU Alpha-1,4 glucan phosphorylase L-2 isozyme, chloroplastic/amyloplastic OS=Solanum tuberosum GN=STP-1 PE=1 SV=1 465 863 1.0E-100
sp|P53536|PHSL_VICFA Alpha-1,4 glucan phosphorylase L isozyme, chloroplastic/amyloplastic OS=Vicia faba GN=PHO1 PE=2 SV=2 465 863 1.0E-99
sp|Q9YGA7|PHSG_THELN Maltodextrin phosphorylase OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) GN=malP PE=1 SV=1 360 734 3.0E-15
sp|Q7U078|PHSG_MYCBO Glycogen phosphorylase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=glgP PE=3 SV=1 364 730 4.0E-14
sp|P9WMW1|PHSG_MYCTU Glycogen phosphorylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=glgP PE=1 SV=1 364 730 4.0E-13
sp|P9WMW0|PHSG_MYCTO Glycogen phosphorylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=glgP PE=3 SV=1 364 730 4.0E-13
sp|O66932|PHSG_AQUAE Glycogen phosphorylase OS=Aquifex aeolicus (strain VF5) GN=glgP PE=3 SV=1 167 734 1.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0008184 glycogen phosphorylase activity Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0004645 1,4-alpha-oligoglucan phosphorylase activity No
GO:0016758 hexosyltransferase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0016757 glycosyltransferase activity No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|020790
MTSTIDPKSIGKPHRPRRHVRTLTGYLPEVDVTGKEKWPKGEEEVWKAGMRGVDKDVSDITKSFVNHAQTSLARQ
AYNLDDFGAYEAAALAARDDLLVNWNETQLNYTRKNPKRAYYLSLEFLMGRTLDNALLNLGLKGEFEEGVKKLGF
NMEDLLEKERDAALGNGGLGRLAACYLDSSASQEIPVWGYGLRYQYGIFQQLISPEGNQLEAPDPWLEHQNPWEL
PRLDVTYEVRFYGHAERSSDGSGRANWSGGQEVMAVAYDVMIPGYNTKTTNNLRLWQSKPKRGFDLNSFNAGNYE
AAVESSNSAAAITSVLYPNDHTSFGKELRLKQQYFWTAASLADILRRFKNTGKPITDFPDYAAIQLNDTHPTLAI
PELMRILIDEEELSWNQAWQIVTNTFFYTNHTVLPEALEKWAVPLVEHVLPRHLQIIYDINMYFLQAVEKKFPGD
RDRLARMSLIEEGYPKQVRMAHLACIGSRKVNGVAELHSELVRTTILKDFVEFEGVSKFGNVTNGVTPRRWLDQC
NHELSDLITKTLKIEKKVWLKDLAKLEGLLAFTEDKNFREQWAAIKQRNKERLARHVQTTLGLTVRTDAMFDVQI
KRLHEYKRQTLNILGVIHRYLTLKSMTPAERSKCNRKVVFFAGKAAPAYYIAKLTIRLIVNVARVINADADTKDF
LQLYFLPDYSVSLAEVLIPASDISQHISTAGTEASGTSNMKFCLNGGLLLGTVDGANIEIAEEVGENNVFFFGHL
TPAVEDLRYQHAYHPVPIEQKCPALAKVLNEVSAGMFGDGGVYEPLLNTIRQGDYYLLTDDFDSYIAALAMVDDA
YLDRDEWIKKSIRTTAKMGKFSSDRAILEYAESYWNLEQTPVS*
Coding >AgabiH97|020790
ATGACCTCTACCATAGACCCCAAGTCCATTGGGAAACCCCATCGGCCGAGGAGGCACGTTCGTACACTCACGGGC
TACCTTCCTGAGGTCGATGTGACTGGTAAGGAGAAATGGCCCAAAGGTGAAGAAGAGGTTTGGAAAGCTGGCATG
CGTGGGGTCGATAAAGATGTCTCCGATATTACGAAGAGTTTTGTTAATCACGCCCAGACATCTCTTGCTCGTCAG
GCCTATAATCTTGATGATTTTGGTGCATACGAGGCCGCTGCTCTCGCTGCCAGGGATGATCTTCTCGTCAACTGG
AACGAGACTCAACTGAACTACACACGCAAAAATCCCAAGCGTGCATACTATCTTTCTTTGGAATTCCTTATGGGC
AGAACTCTTGATAACGCGCTTCTTAACCTTGGTCTCAAGGGCGAGTTCGAAGAGGGTGTCAAGAAACTTGGTTTC
AACATGGAAGATCTCCTTGAGAAAGAACGTGATGCTGCCCTTGGTAACGGTGGGCTAGGCCGTCTGGCAGCTTGT
TACCTTGATTCTTCTGCGTCTCAGGAAATCCCAGTTTGGGGTTATGGTTTAAGGTACCAATATGGTATCTTCCAA
CAGCTCATCTCTCCAGAGGGAAATCAACTCGAGGCTCCTGATCCATGGCTAGAGCATCAGAATCCTTGGGAGTTA
CCTCGTCTTGATGTCACTTACGAAGTGCGGTTCTATGGTCATGCCGAACGTTCGAGCGACGGCAGTGGCCGTGCC
AACTGGTCAGGAGGTCAAGAAGTCATGGCAGTTGCTTATGATGTCATGATTCCTGGTTACAACACCAAGACCACC
AACAATTTACGACTTTGGCAGAGCAAGCCCAAACGTGGGTTTGATTTGAATTCGTTCAATGCTGGTAACTACGAG
GCTGCCGTCGAATCATCCAATAGCGCAGCGGCTATCACTTCTGTTTTGTATCCCAACGATCATACTTCTTTCGGC
AAGGAGCTGAGGTTGAAGCAACAATACTTCTGGACCGCTGCTAGTTTGGCAGATATTCTTCGCAGATTCAAGAAT
ACCGGAAAACCCATCACTGATTTCCCTGACTATGCTGCTATTCAGCTTAATGATACTCACCCTACACTCGCCATT
CCAGAATTGATGCGCATCCTCATCGACGAGGAAGAGCTTTCTTGGAATCAAGCATGGCAAATTGTTACTAACACT
TTCTTCTACACAAACCACACTGTCTTGCCCGAAGCTCTAGAGAAATGGGCTGTTCCCTTGGTCGAGCATGTTCTT
CCTAGGCACTTGCAAATCATCTACGATATCAACATGTACTTCCTTCAAGCCGTAGAAAAGAAGTTCCCTGGTGAT
CGTGACAGGCTCGCGAGAATGTCCTTGATTGAAGAGGGATATCCCAAACAAGTCAGAATGGCTCACTTGGCCTGC
ATTGGTAGCCGTAAGGTGAACGGTGTCGCTGAGCTCCATTCTGAATTGGTGAGGACCACGATCCTCAAGGACTTT
GTCGAGTTCGAGGGTGTCAGCAAGTTCGGCAACGTCACGAACGGAGTCACTCCGCGCCGCTGGCTCGATCAATGC
AACCACGAACTCAGTGATCTAATTACCAAGACATTGAAGATTGAAAAGAAGGTCTGGTTGAAGGATTTGGCCAAG
CTTGAAGGTCTTCTTGCTTTCACCGAAGACAAGAATTTCAGAGAACAATGGGCTGCTATCAAGCAGCGCAACAAG
GAGCGTTTGGCTAGGCATGTTCAGACCACTCTCGGTCTGACTGTTCGAACGGACGCTATGTTCGATGTTCAAATC
AAGCGTTTGCATGAATACAAGCGTCAAACTCTCAACATTCTCGGTGTTATCCACCGCTACCTCACGTTGAAGAGC
ATGACTCCGGCCGAGAGGAGTAAATGCAACCGCAAAGTCGTATTCTTTGCTGGAAAGGCTGCCCCTGCTTACTAT
ATTGCCAAACTCACCATTCGTCTCATTGTCAATGTCGCCCGCGTCATCAATGCCGACGCCGATACCAAAGACTTC
TTGCAGCTCTACTTCCTGCCGGACTACTCTGTATCTCTTGCAGAAGTTTTGATTCCTGCCTCCGATATCAGCCAA
CATATATCAACTGCCGGGACTGAAGCTTCGGGTACTTCGAACATGAAGTTCTGCTTGAACGGAGGTCTCCTTCTT
GGTACTGTTGATGGCGCAAACATTGAGATCGCTGAAGAGGTTGGCGAGAATAACGTTTTCTTCTTTGGTCATTTG
ACACCTGCTGTTGAGGATCTTCGTTATCAACACGCATATCACCCCGTCCCAATCGAGCAGAAATGTCCTGCCCTC
GCCAAGGTCCTCAACGAAGTTTCGGCTGGCATGTTCGGCGACGGTGGTGTATATGAACCCCTCTTGAATACTATC
CGTCAAGGAGATTATTACCTCCTTACTGATGATTTTGATTCATACATCGCCGCCTTGGCTATGGTTGACGATGCG
TATCTTGATCGTGATGAATGGATTAAGAAATCTATCAGGACTACTGCAAAGATGGGCAAGTTCAGTTCTGATCGT
GCAATTCTTGAATATGCAGAGAGCTACTGGAATTTGGAGCAAACCCCTGTTTCCTAA
Transcript >AgabiH97|020790
ATGACCTCTACCATAGACCCCAAGTCCATTGGGAAACCCCATCGGCCGAGGAGGCACGTTCGTACACTCACGGGC
TACCTTCCTGAGGTCGATGTGACTGGTAAGGAGAAATGGCCCAAAGGTGAAGAAGAGGTTTGGAAAGCTGGCATG
CGTGGGGTCGATAAAGATGTCTCCGATATTACGAAGAGTTTTGTTAATCACGCCCAGACATCTCTTGCTCGTCAG
GCCTATAATCTTGATGATTTTGGTGCATACGAGGCCGCTGCTCTCGCTGCCAGGGATGATCTTCTCGTCAACTGG
AACGAGACTCAACTGAACTACACACGCAAAAATCCCAAGCGTGCATACTATCTTTCTTTGGAATTCCTTATGGGC
AGAACTCTTGATAACGCGCTTCTTAACCTTGGTCTCAAGGGCGAGTTCGAAGAGGGTGTCAAGAAACTTGGTTTC
AACATGGAAGATCTCCTTGAGAAAGAACGTGATGCTGCCCTTGGTAACGGTGGGCTAGGCCGTCTGGCAGCTTGT
TACCTTGATTCTTCTGCGTCTCAGGAAATCCCAGTTTGGGGTTATGGTTTAAGGTACCAATATGGTATCTTCCAA
CAGCTCATCTCTCCAGAGGGAAATCAACTCGAGGCTCCTGATCCATGGCTAGAGCATCAGAATCCTTGGGAGTTA
CCTCGTCTTGATGTCACTTACGAAGTGCGGTTCTATGGTCATGCCGAACGTTCGAGCGACGGCAGTGGCCGTGCC
AACTGGTCAGGAGGTCAAGAAGTCATGGCAGTTGCTTATGATGTCATGATTCCTGGTTACAACACCAAGACCACC
AACAATTTACGACTTTGGCAGAGCAAGCCCAAACGTGGGTTTGATTTGAATTCGTTCAATGCTGGTAACTACGAG
GCTGCCGTCGAATCATCCAATAGCGCAGCGGCTATCACTTCTGTTTTGTATCCCAACGATCATACTTCTTTCGGC
AAGGAGCTGAGGTTGAAGCAACAATACTTCTGGACCGCTGCTAGTTTGGCAGATATTCTTCGCAGATTCAAGAAT
ACCGGAAAACCCATCACTGATTTCCCTGACTATGCTGCTATTCAGCTTAATGATACTCACCCTACACTCGCCATT
CCAGAATTGATGCGCATCCTCATCGACGAGGAAGAGCTTTCTTGGAATCAAGCATGGCAAATTGTTACTAACACT
TTCTTCTACACAAACCACACTGTCTTGCCCGAAGCTCTAGAGAAATGGGCTGTTCCCTTGGTCGAGCATGTTCTT
CCTAGGCACTTGCAAATCATCTACGATATCAACATGTACTTCCTTCAAGCCGTAGAAAAGAAGTTCCCTGGTGAT
CGTGACAGGCTCGCGAGAATGTCCTTGATTGAAGAGGGATATCCCAAACAAGTCAGAATGGCTCACTTGGCCTGC
ATTGGTAGCCGTAAGGTGAACGGTGTCGCTGAGCTCCATTCTGAATTGGTGAGGACCACGATCCTCAAGGACTTT
GTCGAGTTCGAGGGTGTCAGCAAGTTCGGCAACGTCACGAACGGAGTCACTCCGCGCCGCTGGCTCGATCAATGC
AACCACGAACTCAGTGATCTAATTACCAAGACATTGAAGATTGAAAAGAAGGTCTGGTTGAAGGATTTGGCCAAG
CTTGAAGGTCTTCTTGCTTTCACCGAAGACAAGAATTTCAGAGAACAATGGGCTGCTATCAAGCAGCGCAACAAG
GAGCGTTTGGCTAGGCATGTTCAGACCACTCTCGGTCTGACTGTTCGAACGGACGCTATGTTCGATGTTCAAATC
AAGCGTTTGCATGAATACAAGCGTCAAACTCTCAACATTCTCGGTGTTATCCACCGCTACCTCACGTTGAAGAGC
ATGACTCCGGCCGAGAGGAGTAAATGCAACCGCAAAGTCGTATTCTTTGCTGGAAAGGCTGCCCCTGCTTACTAT
ATTGCCAAACTCACCATTCGTCTCATTGTCAATGTCGCCCGCGTCATCAATGCCGACGCCGATACCAAAGACTTC
TTGCAGCTCTACTTCCTGCCGGACTACTCTGTATCTCTTGCAGAAGTTTTGATTCCTGCCTCCGATATCAGCCAA
CATATATCAACTGCCGGGACTGAAGCTTCGGGTACTTCGAACATGAAGTTCTGCTTGAACGGAGGTCTCCTTCTT
GGTACTGTTGATGGCGCAAACATTGAGATCGCTGAAGAGGTTGGCGAGAATAACGTTTTCTTCTTTGGTCATTTG
ACACCTGCTGTTGAGGATCTTCGTTATCAACACGCATATCACCCCGTCCCAATCGAGCAGAAATGTCCTGCCCTC
GCCAAGGTCCTCAACGAAGTTTCGGCTGGCATGTTCGGCGACGGTGGTGTATATGAACCCCTCTTGAATACTATC
CGTCAAGGAGATTATTACCTCCTTACTGATGATTTTGATTCATACATCGCCGCCTTGGCTATGGTTGACGATGCG
TATCTTGATCGTGATGAATGGATTAAGAAATCTATCAGGACTACTGCAAAGATGGGCAAGTTCAGTTCTGATCGT
GCAATTCTTGAATATGCAGAGAGCTACTGGAATTTGGAGCAAACCCCTGTTTCCTAA
Gene >AgabiH97|020790
ATGACCTCTACCATAGACCCCAAGTCCATTGGGAAACCCCATCGGCCGAGGAGGCACGTTCGTACACTCACGGGT
GAGACTTTCATCAAATAGGTCATCATCCGGGGCTAATTCCGTACTTGACAGGCTACCTTCCTGAGGTCGATGTGA
CTGGTAAGGAGAAATGGCCCAAAGGTGAAGAAGAGGTTTGGAAAGCTGGCATGCGTGGGGTCGATAAAGGTGTGT
CTGAAGCATCAACCTGAATCGATCTCACAGACAACTCAAAAAACCTGGATAGATGTCTCCGATATTACGAAGAGT
TTTGTTAATCACGCCCAGACATCTCTTGCTCGTCAGGCCTATAATCTTGGTAGATTGCGTTCAGCTGATGCTTTG
CAACGAGGAACTGACTAAAGCAGATGATTTTGGTGCATACGAGGCCGCTGCTCTCGCTGCCAGGGATGATCTTCT
CGTGGGTCTAAGCGGACGAACAGCATTACAGCAATTCTGACGTCGTTGCTTCAGGTCAACTGGAACGAGACTCAA
CTGAACTACACACGCAAAAATCCCAAGCGTGCATACTATCTTTCTTTGGAATTCCTTATGGGCAGAACTCTTGAT
AACGCGGTAAACTCACCACTCATAACCGTCTCTGTACCTCATTTTCTGATGTGCTCGAACTTCAGCTTCTTAACC
TTGGTCTCAAGGGCGAGTTCGAAGAGGGTGTCAAGAAACTTGGTTTCAACATGGAAGATCTCCTTGAGAAAGAAC
GTGATGCTGCCCTTGGTAACGGTGGGCTAGGCCGTCTGGCAGCTTGTTACCTTGATTCTTCTGCGTCTCAGGTAC
TGCATCGGAGGTGTTCATAGAGATCTCTCCACTAATCTAATTTCAAATATCAGGAAATCCCAGTTTGGGGTTATG
GTTTAAGGTACCAATATGGTATCTTCCAACAGCTCATCTCTCCAGAGGGAAATCAACTCGAGGTGTGTATCAGGA
GCTGCAATTCGAACTATACATGGTCCTCATTTGTCTCATAATTAGGCTCCTGATCCATGGCTAGAGCATCAGAAT
CCTTGGGAGGTACGACTCACCCTTTCCGAATCGGATTTTGATTGACTTGAAGCCTGATCATATCATCAGTTACCT
CGTCTTGATGTCACTTACGAAGTGCGGTTCTATGGTCATGCCGAACGTTCGAGCGACGGCAGTGGCCGTGCCAAC
TGGTCAGGAGGTCAAGAAGTCATGGCAGTTGCTTATGATGTCATGATTCCTGGTTACAACACCAAGACCACCAAC
AATTTACGACTTTGGCAGAGCAAGCCCAAACGTGGGTTTGATTTGAATTCGTTCAATGGTGAGTTTTTATCTCCA
ATTATTTTCAATCGTTCCTCGTCTGACTGTTTCTGAAGCTGGTAACTACGAGGCTGCCGTCGAATCATCCAATAG
CGCAGCGGCTATCACTTCTGTTTTGTATCCCAACGATCATACGTCAGTTTAAATTTCATGTCCTATTCCCTGATT
GTTCATTCTTTCTTCAGTTCTTGTAGGCATTCTTGACTTGGTTTATCAGACTGATTTGGCTAACGAAGCTACAGT
CGGCAAGGAGCTGAGGTTGAAGCAACAATAGTTTGTCCCGCGTTTCATTCATATGAATAATATTCTCACATTTTT
GTGAAGCTTCTGGACCGCTGCTAGTTTGGCAGATATTCTTCGCAGATTCAAGAATACCGGAAAACCCATCACTGA
TTTCCCTGACTGTATGTTTATTATGTGATGTTTGGGTTCAGTGTTTCTGACAACCGTCTAGATGCTGCTATTCAG
CTTAATGATGTATGGAGAGCAACGCGTTGAAATTAGACTCGTCTAATCGTTTATAGACTCACCCTACACTCGCCA
TTCCAGAATTGATGCGCATCCTCATCGACGAGGAAGAGCTTTCTTGGAATCAAGCATGGCAAATTGTTACTAACA
CTTTCTTCTACACAAACCACACTGTCTTGCCCGTGCGTGTTCCCTGGAATTTTGTCGGGAAGTGGTCATTGATGA
ATTTCACAGGAAGCTCTAGAGAAATGGGCTGTTCCCTTGGTCGAGCATGTTCTTCCTAGGTATATTTATCGTCAA
ACTAAACCTTCTTTCCATTACTCAACTCATGGCCATTAGGCACTTGCAAATCATCTACGATATCGTGAGCCTAGT
CATCTTTGTCTTTGTAATCACGACTGACCAATTTGTGCAGAACATGTACTTCCTTCAAGCCGTAGAAAAGAAGTT
CCCTGGTGATCGTGACAGGCTCGCGAGAATGTCCTTGATTGAAGGTATATATTCGACTGTATTCGAAAGACAGCA
AATTTAACAGTCGTCTTTCAGAGGGATATCCCAAACAAGTCAGAATGGCTCACTTGGCCTGCATTGGTAAGTGAT
GATAGTTTATGTATTTGACACGATTTTCTGAGGAGATCTATAGGTAGCCGTAAGGTGAACGGTGTCGCTGAGGTG
CGCGATTATCTCATAAAGCTCAAGCGCTATGCTCACACCATATTAGCTCCATTCTGAATTGGTGAGGACCACGAT
CCTCAAGGACTTTGTCGAGTTCGAGGGTGTCAGCAAGTACGCTTAATATCGTTTCTACGTCTTCCAAAGCTCTAA
TTTTCTGATAGGTTCGGCAACGTCACGAACGGAGGTGTGTATTGTGGGGCGCAGCCATATTTTTGCTGACTTTGC
TTCAGTCACTCCGCGCCGCTGGCTCGATCAATGCAACCACGAACTCAGTGATCTAATTACCAAGACATTGAAGAT
TGAAAAGAAGGTCTGGTTGAAGGATTTGGCCAAGCTTGAAGGTCTTCTTGCTTTCACCGAAGACAAGAATTTCAG
AGAACAATGGGCTGCTATCAAGCAGCGCAACAAGGAGCGTTTGGCTAGGCATGTTCAGACCACTCTCGGTCTGAC
TGTTCGAACGGACGCTATGTTCGATGTTCAAATCAAGGTACGATTATTTCACAATCCTGTGGCTTCCAGACCGCT
GAACAGTGTTTCGTAGCGTTTGCATGAATACAAGGTATGGTATTTATCGTACTGGTGAAATTGGAATACTGATTA
TCGGCAGCGTCAAACTCTCAACATTCTCGGTGTTATCCACGTGCGTTACGTCAGTTCTGCACACTTTCACGTTGT
AGCTAATAGCTGCTGGACAGCGCTACCTCACGTTGAAGAGCATGACTCCGGCCGAGAGGAGTAAATGCAACCGCA
AAGTCGTATTCTTTGCTGGAAAGGCTGCCCCTGCTTGTGAGTAACTGCACGTTTCTAAGTATGATGGTGCTCATG
ACAATAACTTTATAGACTATATTGCCAAACTCGTATGTAGTTTTTCTAACGCAAAATCTCGAGGTTTCAAATCGA
GTTTGCTGTTATAGACCATTCGTCTCATTGTCAATGTCGCCCGCGTCATCAATGCCGACGCCGATACCAAAGACT
TCTTGCAGCTCTACTTCCTGCCGGACTACTCTGTATCTCTTGCAGAAGTTTTGATTCCTGCCTCCGATATCAGCC
AACATATATCAACTGCCGGGACTGAAGCTTCGGGTACTTCGAACATGAAGTTCTGCTTGAACGGAGGTCTCCTTC
TTGGTACTGTTGGTGGGTATCAGATATAGTATGTTGTCTCGTTTCTTTTTTCTGACATCACACTCAGATGGCGCA
AACATTGAGATCGCTGAAGAGGTTGGCGAGAATAACGTTTGTGAGTAATGCTGCCCAACATCTAGTCTCTCGATG
TTCACTTTCATTAATAGTCTTCTTTGGTCATTTGACACCGTAAGTAGTAGCGATGAGCTTTCCATTCGTAACTGA
CGATATTTGCTCAGTGCTGTTGAGGATCTTCGTTATCAACACGCATATCACCCCGTCCCAATCGAGCAGAAATGT
CCTGCCCTCGCCAAGGTCCTCAACGAAGTTTCGGCTGGCATGTTCGGCGACGGTGGTGTATATGAACCGTGAGCA
CTCCTATCCAATCCATTGATATGTTCCTGATTAGTGTCCAGCCTCTTGAATACTATCCGTCAAGGAGATTATTAC
CTCCTTACTGATGATTTTGATTCATACATCGCCGCCTTGGCTATGGTTGACGATGCGTATCTTGATCGTGATGAA
TGGATTAAGAAATCTATCAGGACTACTGCAAAGGTCTGTTTCCATGTTTGTATCAACACATAGTTCGCTTGCTTA
GACCTGCACTGTTAGATGGGCAAGTTCAGTTCTGATCGTGCAATTCTTGAATATGCAGAGAGCTACTGGAATTTG
GAGCAAACCCCTGTTTCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail