Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|020550
Gene name
Locationscaffold_10:1477516..1483417
Strand-
Gene length (bp)5901
Transcript length (bp)5901
Coding sequence length (bp)5901
Protein length (aa) 1967

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14214 Helitron_like_N Helitron helicase-like domain at N-terminus 1.1E-29 204 419
PF05970 PIF1 PIF1-like helicase 2.1E-25 1073 1430
PF20209 DUF6570 Domain of unknown function (DUF6570) 6.4E-17 1 81
PF13604 AAA_30 AAA domain 2.4E-10 1073 1238

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9QSK3|VF030_IIV6 Uncharacterized protein 030L OS=Invertebrate iridescent virus 6 GN=IIV6-030L PE=3 SV=1 1070 1544 6.0E-16
sp|Q384Y1|PIF1_TRYB2 ATP-dependent DNA helicase PIF1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=PIF1 PE=1 SV=1 1073 1294 8.0E-16
sp|Q9UUA2|PIF1_SCHPO ATP-dependent DNA helicase pfh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfh1 PE=1 SV=1 1073 1232 2.0E-12
sp|Q57YG0|PIF7_TRYB2 ATP-dependent DNA helicase PIF7 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=PIF7 PE=3 SV=1 1070 1544 4.0E-12
sp|Q6MHJ5|PIF1_BDEBA ATP-dependent DNA helicase pif1 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=pif1 PE=3 SV=1 1098 1314 1.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9QSK3|VF030_IIV6 Uncharacterized protein 030L OS=Invertebrate iridescent virus 6 GN=IIV6-030L PE=3 SV=1 1070 1544 6.0E-16
sp|Q384Y1|PIF1_TRYB2 ATP-dependent DNA helicase PIF1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=PIF1 PE=1 SV=1 1073 1294 8.0E-16
sp|Q9UUA2|PIF1_SCHPO ATP-dependent DNA helicase pfh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfh1 PE=1 SV=1 1073 1232 2.0E-12
sp|Q57YG0|PIF7_TRYB2 ATP-dependent DNA helicase PIF7 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=PIF7 PE=3 SV=1 1070 1544 4.0E-12
sp|Q6MHJ5|PIF1_BDEBA ATP-dependent DNA helicase pif1 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=pif1 PE=3 SV=1 1098 1314 1.0E-11
sp|Q381V6|PIF4_TRYB2 ATP-dependent DNA helicase PIF4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=PIF4 PE=3 SV=1 1069 1226 2.0E-11
sp|P07271|PIF1_YEAST ATP-dependent DNA helicase PIF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIF1 PE=1 SV=2 1098 1292 5.0E-11
sp|A6ZM04|PIF1_YEAS7 ATP-dependent DNA helicase PIF1 OS=Saccharomyces cerevisiae (strain YJM789) GN=PIF1 PE=3 SV=1 1098 1292 5.0E-11
sp|Q384Y0|PIF2_TRYB2 ATP-dependent DNA helicase PIF2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=PIF2 PE=1 SV=1 1073 1234 2.0E-10
sp|Q383A1|PIF3_TRYB2 ATP-dependent DNA helicase PIF3 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=PIF3 PE=3 SV=1 1098 1226 2.0E-10
sp|Q38CE9|PIF6_TRYB2 ATP-dependent DNA helicase PIF6 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=PIF6 PE=3 SV=1 1098 1532 2.0E-10
sp|P38766|RRM3_YEAST ATP-dependent DNA helicase RRM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRM3 PE=1 SV=1 1073 1230 5.0E-10
sp|Q59RQ0|PIF1_CANAL ATP-dependent DNA helicase PIF1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIF1 PE=3 SV=1 1072 1300 5.0E-10
sp|A5WFR0|PIF1_PSYWF ATP-dependent DNA helicase pif1 OS=Psychrobacter sp. (strain PRwf-1) GN=pif1 PE=3 SV=1 1098 1231 2.0E-09
sp|Q0R4F1|PIF1_XENLA ATP-dependent DNA helicase PIF1 OS=Xenopus laevis GN=pif1 PE=2 SV=1 1098 1230 7.0E-09
sp|Q80SX8|PIF1_MOUSE ATP-dependent DNA helicase PIF1 OS=Mus musculus GN=Pif1 PE=1 SV=2 1098 1297 2.0E-08
sp|Q9H611|PIF1_HUMAN ATP-dependent DNA helicase PIF1 OS=Homo sapiens GN=PIF1 PE=1 SV=2 1098 1548 4.0E-08
sp|Q5AXT5|PIF1_EMENI ATP-dependent DNA helicase PIF1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pif1 PE=3 SV=2 1090 1229 1.0E-07
sp|Q1HG60|PIF1_RAT ATP-dependent DNA helicase PIF1 OS=Rattus norvegicus GN=Pif1 PE=2 SV=1 1098 1548 2.0E-07
sp|Q580X6|PIF5_TRYB2 ATP-dependent DNA helicase PIF5 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=PIF5 PE=1 SV=1 984 1309 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003678 DNA helicase activity Yes
GO:0006281 DNA repair Yes
GO:0000723 telomere maintenance Yes
GO:0071840 cellular component organization or biogenesis No
GO:0008152 metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0004386 helicase activity No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0008150 biological_process No
GO:0006996 organelle organization No
GO:0071704 organic substance metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:1901360 organic cyclic compound metabolic process No
GO:0140657 ATP-dependent activity No
GO:0032200 telomere organization No
GO:0051276 chromosome organization No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0006259 DNA metabolic process No
GO:0003674 molecular_function No
GO:0044260 cellular macromolecule metabolic process No
GO:0016043 cellular component organization No
GO:0051716 cellular response to stimulus No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0140097 catalytic activity, acting on DNA No
GO:0033554 cellular response to stress No
GO:0006950 response to stress No
GO:0006807 nitrogen compound metabolic process No
GO:0050896 response to stimulus No
GO:0043170 macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|020550
MSANAIMFQNPTPEIFDVLPPSREKLNEVLAYVFVGHAKPTLDDFKWTPMLVRRQKVRLALQWLKINHSDYSDLV
ISESNLSAYPDEGLPVVVEHCPIDGSINPLVVPLSGEDEDDVEECRFAVHGLTGQEFSQLSVQALKARALQHLRE
GGSVLGIGHPEQPLSIFNNPQLYPQMFPCLFPFGYGGLGNCRMRVRLSDATHKKWLMNYYDKRFQKDLYFPMIAF
NHEQIKRATTNSFLYSKRTNFPAVARRINDLDPDVLKRVSVSYEKSHTFSPKTQQEKDCLALLADINHTASNVQG
SMTSRREMRNEIWSLVKARGAPTWFITFSPADAKHPLSLYYAGNEESFYPTILPSSERNKLMSENPAAAAKCFNF
LVNIFIKHILGVESDHEGFYGKTSAYYATVEQQGRLSLHLHALVWVDGALSPQEIRDRIVNNDHIFETKLVEYLQ
ARCQGEFMTGTFQTVFDKFGTSENTINNVREDPTLTLPAPPPVSCNNRHDCSVSDCENCQALRHWHMAFRETVDA
ILLKSNMHGCRSSVDKLKALNEANAQGHTGLVSFAGNGKFFGCMNKYGECTARFPRDVFPETVVDRTDGRIELRK
REPMMNTFSTLLTYVLRCNLDVTCILTGTAVKALVAYITDYISKAGLNTHHVFKAAYDVLIKNTEAAESSTQEGD
TSSHARKLISKMVNSLAAKMEIGSPMACMYLLGFPDHYTNITFVAFWWRTFVNETWHADRTSEQSGSQENRDNIL
LYRTEDGITGLNMSDDYKYRPVQYEAVSVYTWVQCAKRYKIRESAPLPPSHRQFTVGHPLRDSHQVLYDNSKMIN
VVPNFVGGALPRKDQGDPDYFACVMLTLFKPWRRPEDLKPASDRSWSAELESYEFPSQHQRTMDHFNLAYECLDA
RDDYQATRRKRATGNQATSDEGPTDVELDVVDNGINTNFDDDDFAPEDNTMFNPLVTEIDDAIRAVGWVTVPEPI
NVSAVSDMSRMSVSYSPFEQAVDWKELVRMKRQEILTARQAQRDRTSVINDSNLPDGQSSMVTNSLLLLAPSYFQ
EHYRPPRVSDRVIASQTIADYGLNTEQKRAFSIVANHSTSVAPKQLLMYLGGMGGTGKTQVLRALKAFFASRGQG
HRLVATVPTGSASSLLGGSTYHYLLGINQRKSDNDSNLRSSSLSVARDRIRGIDYIFLDEVSMVACHELCSISKK
LAEINNIHDLPFGGVNFIFSGDFAQLPPVSSNPLYGQMPSISTRLDQRSINTALGLFYWHQVTTVVILKQNMRQI
NSGSADALFRTALQNMRTASCTAQDISFLKSRIVNTSADTYIAHNPVYRKASIIVARNLQKDRLNDLGVLRFASD
ANTVLADFYSLDREVCSTSGRRNVRRMPAKSMQRYLWNTYATNTGMIPGKLRLCYGLPVLIKHNIATELCITNGQ
EAEVVGWRSETMHHGLPVLDVVFVKLVNPPMPVILGTLPVNVVPITPINSVFSCTIADTDTRVTVDRYQIPILPN
FAMTDFASQGKTRTPNVVDLTHCRSHQSFYTCLSRGTSAASTVILKDFKTSHITEGATGWLRQELRALDILDEIT
KRRYEGKLSATVAGTFRVPLIRSFRKSILLSDLQAMGSIEDLQTVDNNLLSGMGQVIPSRLDTQLPDPTDHSSIL
ETSNNIDDSRTTNNNLHRVRQIVPFDIDVQRSLVQTSRLSWVETPHWGTVWDSTNNSCAYDALLSMLFNVWNETK
TGNGSAWPLDGPPLFNRLIGDLEHVGSPSDLVDVRDAFCLTCHTLNPNEFQWGPYLTDIFAVLGVLCSSPVCGEI
FQACPSCGCRTGGKSVSLSHLVCPTLCMETNRDKLWISQALLCLYLPEFDALCRNCLVNDHQCRYSLNVEIAHYP
SVLFVDTSSPKVVMDLSFDVGLVRYKLRGIIYHGNAHFTTRFLLKENKWWYHDGITSGSYCVLDSVASNALDLST
VDSTGATAAVALYVRQ*
Coding >AgabiH97|020550
ATGTCGGCAAACGCAATAATGTTTCAAAATCCTACACCAGAAATATTCGATGTGCTGCCTCCTAGCAGGGAAAAG
TTGAACGAAGTATTAGCTTACGTATTTGTTGGACATGCGAAACCTACGCTCGACGACTTCAAATGGACCCCAATG
CTGGTACGAAGGCAGAAAGTTCGACTAGCTCTTCAGTGGTTAAAGATCAATCACAGCGATTACTCGGACCTCGTA
ATTTCAGAGTCCAACTTGAGCGCTTATCCAGATGAAGGTCTTCCGGTCGTGGTGGAACATTGTCCCATTGATGGA
TCTATCAATCCACTCGTAGTGCCGTTATCAGGTGAAGATGAGGATGATGTAGAAGAATGTCGATTTGCCGTTCAT
GGTTTGACCGGACAAGAATTCTCCCAATTGTCTGTGCAAGCTTTAAAGGCAAGAGCATTGCAACACCTTCGCGAA
GGAGGTTCGGTTCTCGGCATAGGACACCCAGAGCAACCTCTATCAATCTTTAACAATCCTCAGCTATACCCACAG
ATGTTTCCATGTCTATTCCCCTTCGGTTACGGTGGCCTGGGTAATTGCAGGATGCGTGTTCGACTTTCTGATGCA
ACGCACAAGAAATGGTTGATGAATTATTACGATAAACGTTTCCAGAAAGACCTATATTTTCCTATGATTGCTTTC
AACCACGAACAGATAAAGCGAGCCACAACTAACAGTTTCTTATATTCGAAACGCACTAATTTTCCTGCGGTTGCT
CGTCGAATAAACGACTTAGATCCTGATGTTTTGAAACGCGTATCTGTTAGTTATGAAAAATCTCACACATTTTCA
CCTAAAACGCAGCAGGAAAAGGACTGCTTGGCTTTGCTTGCTGACATCAATCACACAGCATCAAACGTGCAAGGA
TCGATGACATCCAGGCGAGAGATGAGAAATGAGATTTGGTCGCTGGTAAAGGCCAGGGGCGCACCCACCTGGTTT
ATAACATTTTCGCCCGCCGATGCAAAACATCCTCTAAGTCTGTATTATGCTGGTAATGAGGAGAGTTTTTATCCT
ACAATTTTGCCGTCCTCCGAACGCAATAAACTGATGTCTGAGAACCCTGCCGCTGCTGCCAAATGTTTTAATTTC
CTTGTAAATATCTTCATAAAGCACATTTTGGGTGTTGAAAGTGACCACGAGGGTTTTTACGGTAAAACGTCAGCA
TATTATGCTACAGTGGAGCAGCAAGGCCGTTTGTCACTGCATCTCCACGCGCTTGTCTGGGTCGACGGGGCACTG
TCGCCTCAAGAGATCCGTGATCGCATTGTTAACAACGATCACATTTTTGAGACCAAACTGGTAGAGTATCTACAA
GCACGTTGTCAAGGAGAGTTCATGACAGGTACCTTTCAGACTGTCTTTGATAAATTCGGAACTTCCGAGAATACT
ATCAACAACGTTAGAGAGGACCCTACTTTAACACTCCCGGCACCTCCTCCGGTTTCGTGTAATAACAGACATGAC
TGCTCCGTTAGTGACTGCGAAAACTGCCAAGCTTTGCGGCATTGGCACATGGCATTCCGCGAAACTGTTGACGCC
ATACTGCTAAAATCGAACATGCATGGCTGCAGGTCATCTGTGGATAAACTGAAGGCATTGAACGAAGCCAATGCT
CAGGGCCATACTGGTCTTGTTTCTTTCGCAGGAAATGGAAAGTTCTTTGGTTGTATGAACAAATACGGGGAATGC
ACTGCTAGGTTTCCCAGAGATGTATTTCCTGAAACCGTCGTCGACCGCACAGACGGTAGAATTGAGCTGAGAAAA
CGAGAACCTATGATGAACACATTTTCCACGTTACTTACATACGTGCTTAGGTGCAATTTAGACGTTACATGTATA
TTAACAGGTACAGCAGTCAAGGCACTTGTGGCGTATATAACTGATTATATATCGAAGGCGGGCTTGAATACCCAT
CATGTTTTCAAAGCTGCCTATGATGTCTTGATCAAAAACACAGAAGCAGCTGAATCATCAACGCAAGAGGGTGAT
ACCTCTAGCCATGCTCGTAAACTGATTTCGAAGATGGTGAACTCATTAGCTGCGAAAATGGAGATTGGTAGCCCT
ATGGCCTGCATGTACCTGCTTGGATTTCCGGACCACTACACAAACATCACTTTCGTCGCATTCTGGTGGCGGACA
TTCGTCAACGAAACATGGCACGCTGACCGAACATCGGAACAAAGTGGCTCACAAGAGAATAGAGATAACATACTG
TTGTACCGAACAGAGGATGGAATTACGGGTCTCAACATGTCTGACGATTACAAATATAGACCGGTCCAATACGAG
GCTGTTTCTGTGTACACATGGGTACAGTGTGCGAAAAGATACAAAATCAGAGAATCAGCTCCTCTCCCACCATCG
CATAGGCAATTTACGGTCGGCCACCCTTTGAGAGACTCTCATCAAGTATTATACGACAACTCCAAGATGATTAAC
GTAGTACCAAATTTTGTAGGAGGCGCCCTCCCACGAAAGGACCAGGGTGATCCTGACTACTTCGCTTGTGTAATG
TTGACTTTGTTCAAACCTTGGAGAAGACCTGAAGATCTGAAACCGGCGAGTGATCGGTCCTGGTCCGCAGAATTG
GAGTCATACGAGTTCCCAAGCCAGCATCAACGAACAATGGATCATTTCAACTTGGCGTATGAATGCCTCGACGCT
CGCGACGATTATCAAGCCACTCGCAGAAAACGTGCAACCGGGAATCAGGCCACATCAGATGAGGGACCTACAGAC
GTGGAACTCGACGTTGTTGATAACGGAATCAATACGAATTTTGACGATGACGACTTTGCGCCAGAAGACAACACG
ATGTTTAATCCCCTTGTAACGGAGATAGACGACGCAATACGTGCTGTAGGCTGGGTTACTGTACCGGAGCCAATA
AACGTGTCAGCGGTTTCTGACATGAGTCGCATGTCCGTCTCATACAGCCCCTTTGAACAAGCTGTTGATTGGAAG
GAACTGGTCCGAATGAAGCGGCAGGAAATTCTGACAGCGAGACAGGCTCAACGAGATCGTACTAGCGTAATCAAT
GACAGTAATCTGCCGGATGGACAGTCGTCGATGGTAACCAATTCTTTGTTGCTGTTGGCCCCTTCGTATTTTCAG
GAGCACTACAGACCACCTCGTGTTTCTGATAGAGTCATTGCATCGCAAACCATCGCGGATTATGGCCTCAATACA
GAACAAAAAAGAGCATTTTCTATTGTAGCCAATCACTCTACGTCGGTAGCACCTAAACAACTGTTGATGTATCTG
GGAGGCATGGGTGGCACTGGGAAGACACAGGTTTTACGAGCATTGAAAGCGTTTTTCGCTTCAAGAGGTCAAGGT
CACCGTCTTGTTGCAACTGTGCCAACCGGATCCGCGTCGTCGCTGTTAGGAGGTTCGACTTACCATTACTTGCTT
GGTATAAATCAACGTAAATCAGATAATGACTCAAACCTCCGATCGTCGTCTTTAAGTGTAGCAAGAGACCGTATA
AGGGGCATTGACTACATTTTCTTGGACGAAGTGTCAATGGTCGCTTGTCATGAACTATGTTCTATCAGTAAGAAG
TTGGCAGAGATCAATAACATCCACGACTTGCCCTTCGGCGGCGTAAACTTCATCTTTTCGGGTGATTTTGCACAA
CTACCGCCAGTGTCAAGCAACCCATTGTATGGTCAAATGCCATCGATATCCACTAGACTTGATCAAAGGTCAATC
AATACGGCACTAGGACTGTTTTACTGGCATCAAGTAACGACAGTCGTCATACTGAAACAGAACATGCGGCAAATA
AACTCGGGATCAGCGGATGCATTATTTAGGACCGCGTTACAGAATATGAGAACAGCTTCCTGTACAGCACAGGAC
ATATCATTTCTGAAATCGCGAATCGTTAACACTTCTGCGGATACATACATCGCCCATAACCCTGTTTACCGTAAG
GCTTCAATCATAGTTGCCAGAAATTTACAGAAAGATCGTTTAAATGACCTTGGGGTGCTACGTTTCGCATCGGAC
GCAAATACTGTGCTGGCTGACTTCTATTCTCTGGATAGAGAAGTTTGTTCAACATCGGGCAGGAGAAACGTTCGG
CGTATGCCCGCAAAATCTATGCAAAGATATCTCTGGAACACTTACGCAACTAATACCGGCATGATTCCAGGTAAA
CTCCGGTTGTGTTATGGGTTACCCGTTCTCATCAAACATAATATTGCTACAGAACTGTGTATTACAAACGGCCAA
GAGGCAGAGGTCGTAGGTTGGCGGTCAGAAACAATGCATCATGGCTTGCCAGTGCTGGACGTCGTCTTTGTCAAG
CTGGTCAACCCGCCGATGCCAGTCATTCTGGGCACTCTACCAGTCAATGTTGTTCCAATCACGCCTATAAACTCT
GTTTTCTCTTGCACTATAGCAGATACAGACACTAGAGTTACGGTTGACCGATATCAAATACCTATATTACCCAAC
TTTGCAATGACCGATTTCGCGTCTCAAGGAAAGACTAGAACCCCAAATGTCGTTGATTTAACTCATTGTCGGAGC
CACCAATCGTTCTACACTTGCCTATCTCGCGGGACATCCGCGGCTTCAACTGTGATCCTGAAAGACTTCAAAACC
AGCCACATTACTGAAGGTGCCACGGGCTGGCTGCGGCAAGAATTACGAGCACTGGATATATTGGACGAAATAACA
AAACGTAGATATGAAGGAAAGTTATCAGCTACTGTAGCAGGGACTTTCCGAGTACCTCTCATACGGTCTTTTCGA
AAGTCGATTCTGTTGAGTGATCTCCAGGCAATGGGGTCCATAGAAGATCTTCAAACAGTGGATAACAACCTCTTA
TCTGGCATGGGGCAGGTCATTCCTTCGAGGCTTGATACACAATTGCCAGACCCGACGGATCACTCTTCTATCCTT
GAAACCTCTAACAATATAGATGATAGTCGTACGACGAACAATAACCTACACCGTGTTCGACAAATTGTCCCTTTC
GACATCGACGTACAAAGATCTCTCGTACAGACCTCCAGATTGTCTTGGGTGGAAACGCCTCATTGGGGTACGGTG
TGGGATTCGACCAATAACAGTTGCGCTTACGACGCCTTGTTGAGCATGTTGTTCAACGTGTGGAATGAAACAAAG
ACTGGTAATGGATCGGCGTGGCCTCTCGACGGTCCCCCACTATTCAATAGGCTCATAGGTGATCTCGAGCACGTA
GGTTCTCCATCGGACCTGGTCGACGTACGAGACGCCTTCTGTCTGACCTGTCACACGCTCAACCCCAATGAGTTT
CAATGGGGACCTTATTTGACAGATATATTCGCCGTTCTAGGTGTTTTGTGCAGTTCGCCGGTTTGTGGGGAGATA
TTTCAAGCATGTCCATCATGTGGATGTAGAACAGGCGGGAAATCCGTCTCACTTTCTCATCTGGTGTGTCCTACG
TTATGCATGGAGACGAATCGCGATAAACTGTGGATATCTCAAGCGCTGCTTTGCTTGTATCTTCCTGAATTCGAT
GCATTGTGTCGCAATTGCTTGGTCAATGACCACCAGTGTAGATATTCCCTCAACGTGGAAATAGCACACTATCCC
TCTGTATTGTTTGTAGATACATCTTCACCCAAGGTTGTTATGGATTTATCATTCGATGTAGGTCTTGTTCGATAC
AAACTGCGAGGCATTATCTATCACGGTAACGCCCATTTCACTACCCGATTTCTGTTGAAAGAGAACAAATGGTGG
TATCATGATGGCATCACATCAGGCAGCTATTGTGTATTGGATTCAGTGGCGTCGAATGCCTTGGATTTAAGTACC
GTAGACAGCACAGGGGCTACAGCTGCCGTGGCACTGTATGTCAGACAATGA
Transcript >AgabiH97|020550
ATGTCGGCAAACGCAATAATGTTTCAAAATCCTACACCAGAAATATTCGATGTGCTGCCTCCTAGCAGGGAAAAG
TTGAACGAAGTATTAGCTTACGTATTTGTTGGACATGCGAAACCTACGCTCGACGACTTCAAATGGACCCCAATG
CTGGTACGAAGGCAGAAAGTTCGACTAGCTCTTCAGTGGTTAAAGATCAATCACAGCGATTACTCGGACCTCGTA
ATTTCAGAGTCCAACTTGAGCGCTTATCCAGATGAAGGTCTTCCGGTCGTGGTGGAACATTGTCCCATTGATGGA
TCTATCAATCCACTCGTAGTGCCGTTATCAGGTGAAGATGAGGATGATGTAGAAGAATGTCGATTTGCCGTTCAT
GGTTTGACCGGACAAGAATTCTCCCAATTGTCTGTGCAAGCTTTAAAGGCAAGAGCATTGCAACACCTTCGCGAA
GGAGGTTCGGTTCTCGGCATAGGACACCCAGAGCAACCTCTATCAATCTTTAACAATCCTCAGCTATACCCACAG
ATGTTTCCATGTCTATTCCCCTTCGGTTACGGTGGCCTGGGTAATTGCAGGATGCGTGTTCGACTTTCTGATGCA
ACGCACAAGAAATGGTTGATGAATTATTACGATAAACGTTTCCAGAAAGACCTATATTTTCCTATGATTGCTTTC
AACCACGAACAGATAAAGCGAGCCACAACTAACAGTTTCTTATATTCGAAACGCACTAATTTTCCTGCGGTTGCT
CGTCGAATAAACGACTTAGATCCTGATGTTTTGAAACGCGTATCTGTTAGTTATGAAAAATCTCACACATTTTCA
CCTAAAACGCAGCAGGAAAAGGACTGCTTGGCTTTGCTTGCTGACATCAATCACACAGCATCAAACGTGCAAGGA
TCGATGACATCCAGGCGAGAGATGAGAAATGAGATTTGGTCGCTGGTAAAGGCCAGGGGCGCACCCACCTGGTTT
ATAACATTTTCGCCCGCCGATGCAAAACATCCTCTAAGTCTGTATTATGCTGGTAATGAGGAGAGTTTTTATCCT
ACAATTTTGCCGTCCTCCGAACGCAATAAACTGATGTCTGAGAACCCTGCCGCTGCTGCCAAATGTTTTAATTTC
CTTGTAAATATCTTCATAAAGCACATTTTGGGTGTTGAAAGTGACCACGAGGGTTTTTACGGTAAAACGTCAGCA
TATTATGCTACAGTGGAGCAGCAAGGCCGTTTGTCACTGCATCTCCACGCGCTTGTCTGGGTCGACGGGGCACTG
TCGCCTCAAGAGATCCGTGATCGCATTGTTAACAACGATCACATTTTTGAGACCAAACTGGTAGAGTATCTACAA
GCACGTTGTCAAGGAGAGTTCATGACAGGTACCTTTCAGACTGTCTTTGATAAATTCGGAACTTCCGAGAATACT
ATCAACAACGTTAGAGAGGACCCTACTTTAACACTCCCGGCACCTCCTCCGGTTTCGTGTAATAACAGACATGAC
TGCTCCGTTAGTGACTGCGAAAACTGCCAAGCTTTGCGGCATTGGCACATGGCATTCCGCGAAACTGTTGACGCC
ATACTGCTAAAATCGAACATGCATGGCTGCAGGTCATCTGTGGATAAACTGAAGGCATTGAACGAAGCCAATGCT
CAGGGCCATACTGGTCTTGTTTCTTTCGCAGGAAATGGAAAGTTCTTTGGTTGTATGAACAAATACGGGGAATGC
ACTGCTAGGTTTCCCAGAGATGTATTTCCTGAAACCGTCGTCGACCGCACAGACGGTAGAATTGAGCTGAGAAAA
CGAGAACCTATGATGAACACATTTTCCACGTTACTTACATACGTGCTTAGGTGCAATTTAGACGTTACATGTATA
TTAACAGGTACAGCAGTCAAGGCACTTGTGGCGTATATAACTGATTATATATCGAAGGCGGGCTTGAATACCCAT
CATGTTTTCAAAGCTGCCTATGATGTCTTGATCAAAAACACAGAAGCAGCTGAATCATCAACGCAAGAGGGTGAT
ACCTCTAGCCATGCTCGTAAACTGATTTCGAAGATGGTGAACTCATTAGCTGCGAAAATGGAGATTGGTAGCCCT
ATGGCCTGCATGTACCTGCTTGGATTTCCGGACCACTACACAAACATCACTTTCGTCGCATTCTGGTGGCGGACA
TTCGTCAACGAAACATGGCACGCTGACCGAACATCGGAACAAAGTGGCTCACAAGAGAATAGAGATAACATACTG
TTGTACCGAACAGAGGATGGAATTACGGGTCTCAACATGTCTGACGATTACAAATATAGACCGGTCCAATACGAG
GCTGTTTCTGTGTACACATGGGTACAGTGTGCGAAAAGATACAAAATCAGAGAATCAGCTCCTCTCCCACCATCG
CATAGGCAATTTACGGTCGGCCACCCTTTGAGAGACTCTCATCAAGTATTATACGACAACTCCAAGATGATTAAC
GTAGTACCAAATTTTGTAGGAGGCGCCCTCCCACGAAAGGACCAGGGTGATCCTGACTACTTCGCTTGTGTAATG
TTGACTTTGTTCAAACCTTGGAGAAGACCTGAAGATCTGAAACCGGCGAGTGATCGGTCCTGGTCCGCAGAATTG
GAGTCATACGAGTTCCCAAGCCAGCATCAACGAACAATGGATCATTTCAACTTGGCGTATGAATGCCTCGACGCT
CGCGACGATTATCAAGCCACTCGCAGAAAACGTGCAACCGGGAATCAGGCCACATCAGATGAGGGACCTACAGAC
GTGGAACTCGACGTTGTTGATAACGGAATCAATACGAATTTTGACGATGACGACTTTGCGCCAGAAGACAACACG
ATGTTTAATCCCCTTGTAACGGAGATAGACGACGCAATACGTGCTGTAGGCTGGGTTACTGTACCGGAGCCAATA
AACGTGTCAGCGGTTTCTGACATGAGTCGCATGTCCGTCTCATACAGCCCCTTTGAACAAGCTGTTGATTGGAAG
GAACTGGTCCGAATGAAGCGGCAGGAAATTCTGACAGCGAGACAGGCTCAACGAGATCGTACTAGCGTAATCAAT
GACAGTAATCTGCCGGATGGACAGTCGTCGATGGTAACCAATTCTTTGTTGCTGTTGGCCCCTTCGTATTTTCAG
GAGCACTACAGACCACCTCGTGTTTCTGATAGAGTCATTGCATCGCAAACCATCGCGGATTATGGCCTCAATACA
GAACAAAAAAGAGCATTTTCTATTGTAGCCAATCACTCTACGTCGGTAGCACCTAAACAACTGTTGATGTATCTG
GGAGGCATGGGTGGCACTGGGAAGACACAGGTTTTACGAGCATTGAAAGCGTTTTTCGCTTCAAGAGGTCAAGGT
CACCGTCTTGTTGCAACTGTGCCAACCGGATCCGCGTCGTCGCTGTTAGGAGGTTCGACTTACCATTACTTGCTT
GGTATAAATCAACGTAAATCAGATAATGACTCAAACCTCCGATCGTCGTCTTTAAGTGTAGCAAGAGACCGTATA
AGGGGCATTGACTACATTTTCTTGGACGAAGTGTCAATGGTCGCTTGTCATGAACTATGTTCTATCAGTAAGAAG
TTGGCAGAGATCAATAACATCCACGACTTGCCCTTCGGCGGCGTAAACTTCATCTTTTCGGGTGATTTTGCACAA
CTACCGCCAGTGTCAAGCAACCCATTGTATGGTCAAATGCCATCGATATCCACTAGACTTGATCAAAGGTCAATC
AATACGGCACTAGGACTGTTTTACTGGCATCAAGTAACGACAGTCGTCATACTGAAACAGAACATGCGGCAAATA
AACTCGGGATCAGCGGATGCATTATTTAGGACCGCGTTACAGAATATGAGAACAGCTTCCTGTACAGCACAGGAC
ATATCATTTCTGAAATCGCGAATCGTTAACACTTCTGCGGATACATACATCGCCCATAACCCTGTTTACCGTAAG
GCTTCAATCATAGTTGCCAGAAATTTACAGAAAGATCGTTTAAATGACCTTGGGGTGCTACGTTTCGCATCGGAC
GCAAATACTGTGCTGGCTGACTTCTATTCTCTGGATAGAGAAGTTTGTTCAACATCGGGCAGGAGAAACGTTCGG
CGTATGCCCGCAAAATCTATGCAAAGATATCTCTGGAACACTTACGCAACTAATACCGGCATGATTCCAGGTAAA
CTCCGGTTGTGTTATGGGTTACCCGTTCTCATCAAACATAATATTGCTACAGAACTGTGTATTACAAACGGCCAA
GAGGCAGAGGTCGTAGGTTGGCGGTCAGAAACAATGCATCATGGCTTGCCAGTGCTGGACGTCGTCTTTGTCAAG
CTGGTCAACCCGCCGATGCCAGTCATTCTGGGCACTCTACCAGTCAATGTTGTTCCAATCACGCCTATAAACTCT
GTTTTCTCTTGCACTATAGCAGATACAGACACTAGAGTTACGGTTGACCGATATCAAATACCTATATTACCCAAC
TTTGCAATGACCGATTTCGCGTCTCAAGGAAAGACTAGAACCCCAAATGTCGTTGATTTAACTCATTGTCGGAGC
CACCAATCGTTCTACACTTGCCTATCTCGCGGGACATCCGCGGCTTCAACTGTGATCCTGAAAGACTTCAAAACC
AGCCACATTACTGAAGGTGCCACGGGCTGGCTGCGGCAAGAATTACGAGCACTGGATATATTGGACGAAATAACA
AAACGTAGATATGAAGGAAAGTTATCAGCTACTGTAGCAGGGACTTTCCGAGTACCTCTCATACGGTCTTTTCGA
AAGTCGATTCTGTTGAGTGATCTCCAGGCAATGGGGTCCATAGAAGATCTTCAAACAGTGGATAACAACCTCTTA
TCTGGCATGGGGCAGGTCATTCCTTCGAGGCTTGATACACAATTGCCAGACCCGACGGATCACTCTTCTATCCTT
GAAACCTCTAACAATATAGATGATAGTCGTACGACGAACAATAACCTACACCGTGTTCGACAAATTGTCCCTTTC
GACATCGACGTACAAAGATCTCTCGTACAGACCTCCAGATTGTCTTGGGTGGAAACGCCTCATTGGGGTACGGTG
TGGGATTCGACCAATAACAGTTGCGCTTACGACGCCTTGTTGAGCATGTTGTTCAACGTGTGGAATGAAACAAAG
ACTGGTAATGGATCGGCGTGGCCTCTCGACGGTCCCCCACTATTCAATAGGCTCATAGGTGATCTCGAGCACGTA
GGTTCTCCATCGGACCTGGTCGACGTACGAGACGCCTTCTGTCTGACCTGTCACACGCTCAACCCCAATGAGTTT
CAATGGGGACCTTATTTGACAGATATATTCGCCGTTCTAGGTGTTTTGTGCAGTTCGCCGGTTTGTGGGGAGATA
TTTCAAGCATGTCCATCATGTGGATGTAGAACAGGCGGGAAATCCGTCTCACTTTCTCATCTGGTGTGTCCTACG
TTATGCATGGAGACGAATCGCGATAAACTGTGGATATCTCAAGCGCTGCTTTGCTTGTATCTTCCTGAATTCGAT
GCATTGTGTCGCAATTGCTTGGTCAATGACCACCAGTGTAGATATTCCCTCAACGTGGAAATAGCACACTATCCC
TCTGTATTGTTTGTAGATACATCTTCACCCAAGGTTGTTATGGATTTATCATTCGATGTAGGTCTTGTTCGATAC
AAACTGCGAGGCATTATCTATCACGGTAACGCCCATTTCACTACCCGATTTCTGTTGAAAGAGAACAAATGGTGG
TATCATGATGGCATCACATCAGGCAGCTATTGTGTATTGGATTCAGTGGCGTCGAATGCCTTGGATTTAAGTACC
GTAGACAGCACAGGGGCTACAGCTGCCGTGGCACTGTATGTCAGACAATGA
Gene >AgabiH97|020550
ATGTCGGCAAACGCAATAATGTTTCAAAATCCTACACCAGAAATATTCGATGTGCTGCCTCCTAGCAGGGAAAAG
TTGAACGAAGTATTAGCTTACGTATTTGTTGGACATGCGAAACCTACGCTCGACGACTTCAAATGGACCCCAATG
CTGGTACGAAGGCAGAAAGTTCGACTAGCTCTTCAGTGGTTAAAGATCAATCACAGCGATTACTCGGACCTCGTA
ATTTCAGAGTCCAACTTGAGCGCTTATCCAGATGAAGGTCTTCCGGTCGTGGTGGAACATTGTCCCATTGATGGA
TCTATCAATCCACTCGTAGTGCCGTTATCAGGTGAAGATGAGGATGATGTAGAAGAATGTCGATTTGCCGTTCAT
GGTTTGACCGGACAAGAATTCTCCCAATTGTCTGTGCAAGCTTTAAAGGCAAGAGCATTGCAACACCTTCGCGAA
GGAGGTTCGGTTCTCGGCATAGGACACCCAGAGCAACCTCTATCAATCTTTAACAATCCTCAGCTATACCCACAG
ATGTTTCCATGTCTATTCCCCTTCGGTTACGGTGGCCTGGGTAATTGCAGGATGCGTGTTCGACTTTCTGATGCA
ACGCACAAGAAATGGTTGATGAATTATTACGATAAACGTTTCCAGAAAGACCTATATTTTCCTATGATTGCTTTC
AACCACGAACAGATAAAGCGAGCCACAACTAACAGTTTCTTATATTCGAAACGCACTAATTTTCCTGCGGTTGCT
CGTCGAATAAACGACTTAGATCCTGATGTTTTGAAACGCGTATCTGTTAGTTATGAAAAATCTCACACATTTTCA
CCTAAAACGCAGCAGGAAAAGGACTGCTTGGCTTTGCTTGCTGACATCAATCACACAGCATCAAACGTGCAAGGA
TCGATGACATCCAGGCGAGAGATGAGAAATGAGATTTGGTCGCTGGTAAAGGCCAGGGGCGCACCCACCTGGTTT
ATAACATTTTCGCCCGCCGATGCAAAACATCCTCTAAGTCTGTATTATGCTGGTAATGAGGAGAGTTTTTATCCT
ACAATTTTGCCGTCCTCCGAACGCAATAAACTGATGTCTGAGAACCCTGCCGCTGCTGCCAAATGTTTTAATTTC
CTTGTAAATATCTTCATAAAGCACATTTTGGGTGTTGAAAGTGACCACGAGGGTTTTTACGGTAAAACGTCAGCA
TATTATGCTACAGTGGAGCAGCAAGGCCGTTTGTCACTGCATCTCCACGCGCTTGTCTGGGTCGACGGGGCACTG
TCGCCTCAAGAGATCCGTGATCGCATTGTTAACAACGATCACATTTTTGAGACCAAACTGGTAGAGTATCTACAA
GCACGTTGTCAAGGAGAGTTCATGACAGGTACCTTTCAGACTGTCTTTGATAAATTCGGAACTTCCGAGAATACT
ATCAACAACGTTAGAGAGGACCCTACTTTAACACTCCCGGCACCTCCTCCGGTTTCGTGTAATAACAGACATGAC
TGCTCCGTTAGTGACTGCGAAAACTGCCAAGCTTTGCGGCATTGGCACATGGCATTCCGCGAAACTGTTGACGCC
ATACTGCTAAAATCGAACATGCATGGCTGCAGGTCATCTGTGGATAAACTGAAGGCATTGAACGAAGCCAATGCT
CAGGGCCATACTGGTCTTGTTTCTTTCGCAGGAAATGGAAAGTTCTTTGGTTGTATGAACAAATACGGGGAATGC
ACTGCTAGGTTTCCCAGAGATGTATTTCCTGAAACCGTCGTCGACCGCACAGACGGTAGAATTGAGCTGAGAAAA
CGAGAACCTATGATGAACACATTTTCCACGTTACTTACATACGTGCTTAGGTGCAATTTAGACGTTACATGTATA
TTAACAGGTACAGCAGTCAAGGCACTTGTGGCGTATATAACTGATTATATATCGAAGGCGGGCTTGAATACCCAT
CATGTTTTCAAAGCTGCCTATGATGTCTTGATCAAAAACACAGAAGCAGCTGAATCATCAACGCAAGAGGGTGAT
ACCTCTAGCCATGCTCGTAAACTGATTTCGAAGATGGTGAACTCATTAGCTGCGAAAATGGAGATTGGTAGCCCT
ATGGCCTGCATGTACCTGCTTGGATTTCCGGACCACTACACAAACATCACTTTCGTCGCATTCTGGTGGCGGACA
TTCGTCAACGAAACATGGCACGCTGACCGAACATCGGAACAAAGTGGCTCACAAGAGAATAGAGATAACATACTG
TTGTACCGAACAGAGGATGGAATTACGGGTCTCAACATGTCTGACGATTACAAATATAGACCGGTCCAATACGAG
GCTGTTTCTGTGTACACATGGGTACAGTGTGCGAAAAGATACAAAATCAGAGAATCAGCTCCTCTCCCACCATCG
CATAGGCAATTTACGGTCGGCCACCCTTTGAGAGACTCTCATCAAGTATTATACGACAACTCCAAGATGATTAAC
GTAGTACCAAATTTTGTAGGAGGCGCCCTCCCACGAAAGGACCAGGGTGATCCTGACTACTTCGCTTGTGTAATG
TTGACTTTGTTCAAACCTTGGAGAAGACCTGAAGATCTGAAACCGGCGAGTGATCGGTCCTGGTCCGCAGAATTG
GAGTCATACGAGTTCCCAAGCCAGCATCAACGAACAATGGATCATTTCAACTTGGCGTATGAATGCCTCGACGCT
CGCGACGATTATCAAGCCACTCGCAGAAAACGTGCAACCGGGAATCAGGCCACATCAGATGAGGGACCTACAGAC
GTGGAACTCGACGTTGTTGATAACGGAATCAATACGAATTTTGACGATGACGACTTTGCGCCAGAAGACAACACG
ATGTTTAATCCCCTTGTAACGGAGATAGACGACGCAATACGTGCTGTAGGCTGGGTTACTGTACCGGAGCCAATA
AACGTGTCAGCGGTTTCTGACATGAGTCGCATGTCCGTCTCATACAGCCCCTTTGAACAAGCTGTTGATTGGAAG
GAACTGGTCCGAATGAAGCGGCAGGAAATTCTGACAGCGAGACAGGCTCAACGAGATCGTACTAGCGTAATCAAT
GACAGTAATCTGCCGGATGGACAGTCGTCGATGGTAACCAATTCTTTGTTGCTGTTGGCCCCTTCGTATTTTCAG
GAGCACTACAGACCACCTCGTGTTTCTGATAGAGTCATTGCATCGCAAACCATCGCGGATTATGGCCTCAATACA
GAACAAAAAAGAGCATTTTCTATTGTAGCCAATCACTCTACGTCGGTAGCACCTAAACAACTGTTGATGTATCTG
GGAGGCATGGGTGGCACTGGGAAGACACAGGTTTTACGAGCATTGAAAGCGTTTTTCGCTTCAAGAGGTCAAGGT
CACCGTCTTGTTGCAACTGTGCCAACCGGATCCGCGTCGTCGCTGTTAGGAGGTTCGACTTACCATTACTTGCTT
GGTATAAATCAACGTAAATCAGATAATGACTCAAACCTCCGATCGTCGTCTTTAAGTGTAGCAAGAGACCGTATA
AGGGGCATTGACTACATTTTCTTGGACGAAGTGTCAATGGTCGCTTGTCATGAACTATGTTCTATCAGTAAGAAG
TTGGCAGAGATCAATAACATCCACGACTTGCCCTTCGGCGGCGTAAACTTCATCTTTTCGGGTGATTTTGCACAA
CTACCGCCAGTGTCAAGCAACCCATTGTATGGTCAAATGCCATCGATATCCACTAGACTTGATCAAAGGTCAATC
AATACGGCACTAGGACTGTTTTACTGGCATCAAGTAACGACAGTCGTCATACTGAAACAGAACATGCGGCAAATA
AACTCGGGATCAGCGGATGCATTATTTAGGACCGCGTTACAGAATATGAGAACAGCTTCCTGTACAGCACAGGAC
ATATCATTTCTGAAATCGCGAATCGTTAACACTTCTGCGGATACATACATCGCCCATAACCCTGTTTACCGTAAG
GCTTCAATCATAGTTGCCAGAAATTTACAGAAAGATCGTTTAAATGACCTTGGGGTGCTACGTTTCGCATCGGAC
GCAAATACTGTGCTGGCTGACTTCTATTCTCTGGATAGAGAAGTTTGTTCAACATCGGGCAGGAGAAACGTTCGG
CGTATGCCCGCAAAATCTATGCAAAGATATCTCTGGAACACTTACGCAACTAATACCGGCATGATTCCAGGTAAA
CTCCGGTTGTGTTATGGGTTACCCGTTCTCATCAAACATAATATTGCTACAGAACTGTGTATTACAAACGGCCAA
GAGGCAGAGGTCGTAGGTTGGCGGTCAGAAACAATGCATCATGGCTTGCCAGTGCTGGACGTCGTCTTTGTCAAG
CTGGTCAACCCGCCGATGCCAGTCATTCTGGGCACTCTACCAGTCAATGTTGTTCCAATCACGCCTATAAACTCT
GTTTTCTCTTGCACTATAGCAGATACAGACACTAGAGTTACGGTTGACCGATATCAAATACCTATATTACCCAAC
TTTGCAATGACCGATTTCGCGTCTCAAGGAAAGACTAGAACCCCAAATGTCGTTGATTTAACTCATTGTCGGAGC
CACCAATCGTTCTACACTTGCCTATCTCGCGGGACATCCGCGGCTTCAACTGTGATCCTGAAAGACTTCAAAACC
AGCCACATTACTGAAGGTGCCACGGGCTGGCTGCGGCAAGAATTACGAGCACTGGATATATTGGACGAAATAACA
AAACGTAGATATGAAGGAAAGTTATCAGCTACTGTAGCAGGGACTTTCCGAGTACCTCTCATACGGTCTTTTCGA
AAGTCGATTCTGTTGAGTGATCTCCAGGCAATGGGGTCCATAGAAGATCTTCAAACAGTGGATAACAACCTCTTA
TCTGGCATGGGGCAGGTCATTCCTTCGAGGCTTGATACACAATTGCCAGACCCGACGGATCACTCTTCTATCCTT
GAAACCTCTAACAATATAGATGATAGTCGTACGACGAACAATAACCTACACCGTGTTCGACAAATTGTCCCTTTC
GACATCGACGTACAAAGATCTCTCGTACAGACCTCCAGATTGTCTTGGGTGGAAACGCCTCATTGGGGTACGGTG
TGGGATTCGACCAATAACAGTTGCGCTTACGACGCCTTGTTGAGCATGTTGTTCAACGTGTGGAATGAAACAAAG
ACTGGTAATGGATCGGCGTGGCCTCTCGACGGTCCCCCACTATTCAATAGGCTCATAGGTGATCTCGAGCACGTA
GGTTCTCCATCGGACCTGGTCGACGTACGAGACGCCTTCTGTCTGACCTGTCACACGCTCAACCCCAATGAGTTT
CAATGGGGACCTTATTTGACAGATATATTCGCCGTTCTAGGTGTTTTGTGCAGTTCGCCGGTTTGTGGGGAGATA
TTTCAAGCATGTCCATCATGTGGATGTAGAACAGGCGGGAAATCCGTCTCACTTTCTCATCTGGTGTGTCCTACG
TTATGCATGGAGACGAATCGCGATAAACTGTGGATATCTCAAGCGCTGCTTTGCTTGTATCTTCCTGAATTCGAT
GCATTGTGTCGCAATTGCTTGGTCAATGACCACCAGTGTAGATATTCCCTCAACGTGGAAATAGCACACTATCCC
TCTGTATTGTTTGTAGATACATCTTCACCCAAGGTTGTTATGGATTTATCATTCGATGTAGGTCTTGTTCGATAC
AAACTGCGAGGCATTATCTATCACGGTAACGCCCATTTCACTACCCGATTTCTGTTGAAAGAGAACAAATGGTGG
TATCATGATGGCATCACATCAGGCAGCTATTGTGTATTGGATTCAGTGGCGTCGAATGCCTTGGATTTAAGTACC
GTAGACAGCACAGGGGCTACAGCTGCCGTGGCACTGTATGTCAGACAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail