Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|020470
Gene name
Locationscaffold_10:1450278..1454588
Strand-
Gene length (bp)4310
Transcript length (bp)3525
Coding sequence length (bp)3525
Protein length (aa) 1175

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13374 TPR_10 Tetratricopeptide repeat 5.3E-06 775 813
PF13374 TPR_10 Tetratricopeptide repeat 3.2E-12 814 855
PF13374 TPR_10 Tetratricopeptide repeat 7.5E-08 856 896
PF13374 TPR_10 Tetratricopeptide repeat 2.9E-10 898 939
PF13374 TPR_10 Tetratricopeptide repeat 1.9E-08 940 981
PF13374 TPR_10 Tetratricopeptide repeat 2.0E-11 982 1022
PF13374 TPR_10 Tetratricopeptide repeat 1.0E-09 1024 1064
PF13374 TPR_10 Tetratricopeptide repeat 2.3E-08 1066 1103
PF13424 TPR_12 Tetratricopeptide repeat 2.1E-12 773 837
PF13424 TPR_12 Tetratricopeptide repeat 9.1E-09 901 952
PF13424 TPR_12 Tetratricopeptide repeat 3.0E-09 996 1047
PF13424 TPR_12 Tetratricopeptide repeat 2.5E-10 1030 1089
PF01734 Patatin Patatin-like phospholipase 3.1E-20 30 232
PF13176 TPR_7 Tetratricopeptide repeat 6.4E-03 986 1012
PF00931 NB-ARC NB-ARC domain 1.3E-05 408 600

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 812 1099 2.0E-29
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 812 1101 1.0E-27
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 812 1140 8.0E-27
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 799 1116 1.0E-26
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 812 1140 1.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 812 1099 2.0E-29
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 812 1101 1.0E-27
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 812 1140 8.0E-27
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 799 1116 1.0E-26
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 812 1140 1.0E-26
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 799 1111 2.0E-26
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 812 1140 2.0E-26
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 799 1112 4.0E-26
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 812 1101 6.0E-26
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 812 1115 9.0E-26
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 799 1116 1.0E-25
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 812 1090 2.0E-25
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 812 1117 3.0E-25
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 812 1117 5.0E-25
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 812 1117 5.0E-25
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 812 1083 3.0E-24
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 799 1117 1.0E-23
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 812 1108 3.0E-23
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 850 1047 6.0E-23
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 847 1090 7.0E-23
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 764 1015 8.0E-23
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 891 1106 3.0E-22
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 850 1047 4.0E-22
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 892 1094 6.0E-22
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 850 1047 7.0E-22
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 892 1094 8.0E-22
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 892 1094 3.0E-21
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 812 1025 5.0E-21
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 854 1118 5.0E-21
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 812 1013 7.0E-21
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 812 1025 7.0E-21
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 892 1096 7.0E-21
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 854 1118 8.0E-21
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 775 1062 1.0E-20
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 889 1094 1.0E-20
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 892 1096 2.0E-20
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 812 1013 2.0E-20
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 812 1013 2.0E-20
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 854 1078 4.0E-20
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 774 1031 6.0E-20
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 854 1054 6.0E-20
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 854 1103 6.0E-20
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 774 1017 7.0E-20
sp|Q8K1N1|PLPL8_MOUSE Calcium-independent phospholipase A2-gamma OS=Mus musculus GN=Pnpla8 PE=1 SV=1 20 349 1.0E-19
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 624 1067 1.0E-19
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 775 1053 2.0E-19
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 774 1031 2.0E-19
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 775 1053 2.0E-19
sp|Q9NP80|PLPL8_HUMAN Calcium-independent phospholipase A2-gamma OS=Homo sapiens GN=PNPLA8 PE=1 SV=1 20 349 3.0E-19
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 746 1015 3.0E-19
sp|Q5XTS1|PLPL8_RABIT Calcium-independent phospholipase A2-gamma OS=Oryctolagus cuniculus GN=PNPLA8 PE=1 SV=1 20 339 4.0E-19
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 775 1031 4.0E-19
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 850 1096 5.0E-19
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 765 1053 6.0E-19
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 892 1094 9.0E-19
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 623 1030 2.0E-18
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 775 1053 3.0E-18
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 775 1073 4.0E-18
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 892 1096 7.0E-18
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 774 1031 8.0E-18
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 765 1053 8.0E-18
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 771 1031 2.0E-17
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 774 1031 7.0E-17
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 774 934 8.0E-17
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 774 934 9.0E-17
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 775 971 1.0E-16
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 765 1053 1.0E-16
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 774 943 1.0E-16
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 774 928 2.0E-16
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 774 928 2.0E-16
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 775 971 3.0E-16
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 775 971 3.0E-16
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 775 971 4.0E-16
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 775 971 4.0E-16
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 775 971 5.0E-16
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 934 1102 6.0E-16
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 934 1102 6.0E-16
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 938 1102 7.0E-16
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 775 971 1.0E-15
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 775 971 4.0E-15
sp|F4HX15|LPAI_ARATH Phospholipase A I OS=Arabidopsis thaliana GN=PLA1 PE=2 SV=1 27 346 5.0E-15
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 775 980 6.0E-15
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 769 980 1.0E-14
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 976 1103 5.0E-11
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 807 1102 1.0E-10
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 976 1103 1.0E-10
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 934 1102 3.0E-10
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 976 1103 6.0E-10
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 973 1102 9.0E-10
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 980 1103 2.0E-09
sp|B8AQW7|PLP1_ORYSI Patatin-like protein 1 OS=Oryza sativa subsp. indica GN=PLP1 PE=3 SV=1 21 307 2.0E-09
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 976 1103 1.0E-08
sp|Q93ZQ3|PLP9_ARATH Probable inactive patatin-like protein 9 OS=Arabidopsis thaliana GN=PLP9 PE=2 SV=1 15 233 2.0E-08
sp|Q84QY3|PLP1_ORYSJ Patatin-like protein 1 OS=Oryza sativa subsp. japonica GN=PLP1 PE=3 SV=1 21 307 2.0E-08
sp|Q6ZJD3|PLP2_ORYSJ Patatin-like protein 2 OS=Oryza sativa subsp. japonica GN=PLP2 PE=3 SV=1 27 237 8.0E-08
sp|A2YW91|PLP2_ORYSI Patatin-like protein 2 OS=Oryza sativa subsp. indica GN=PLP2 PE=3 SV=1 27 237 8.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0005515 protein binding Yes
GO:0043531 ADP binding Yes
GO:0008152 metabolic process No
GO:0036094 small molecule binding No
GO:0030554 adenyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0071704 organic substance metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:0017076 purine nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0044238 primary metabolic process No
GO:0032553 ribonucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|020470
MSSRTRNSGSPSTFWAFRCESLDGPPLRLLALDGGGIRGLSELLIIKEVMHKLMFEENEKRKRDGEEPLSVLPKP
CDYFDLIGGTGTGGIIALMLGRLRMDVDTAIKIYDDLAKRVFSAMKRWGKGRFKATTLEAAMKSVVETVTGDSES
PLLEADQAGVCRTFVCAKSAHNMNTPVLLRTYQSRETHVNCKIWEAARATSAAPIFFKRIEIGRNQPFIDGGLGR
NNPSQVVLEEANALFGARQIGCLVSIGTGQAGIIGIKKPGVWQRNIPKAVIDALRAITTDCESTHEVMLHRFSFL
PYTYFRVNVEQGMQRLELSEWEKLDNVKAHTMQYMQKEEVAEKLALLVSAIRVPRGQLLLEQLVTPRHPNESVPQ
AREHKRCPLPVQPFIGREEILDQMRKYFELGGDSPRVFVLHGLGGSGKTQIAFKFVQESTCFSNVFYIDATNEQT
LRTDLEAITPGNTERSVDASLHWLASQREGKWLLVFDHADGVNLKLKRFIPQCRFGNVLVTTRNRDLRHLSAKDG
DAKVGAMEHEDAKNLLLDRARAEESDENKVLAEAIVKDLHYFALAISQAGAYIHCHLSLSEYREFYRRHHDKLLQ
NEEFQGGDPYDRAVYATWSLSYDELDASARSLLQIFSVLHHEGISEEMFEKAASSEMQLEDSELQLKVTELLNML
GKRGPDWSWDFKQVIARLISFSLIEYDNQNHTYSIHPLVQQWSCSTMAGNRQLMQKCVLSIICLSISSSFDQDYN
YRHTLLQHISSSRASVDPGQLTPSVLNGMALVCFEQGQWKEAEELWVVAMEKRKRLLSNDHPDTLMSMANLALTY
RDQGQWKEAEELQVVVMEKTKQLLGDDHPDTLMSMANLAATYRNQEQLKKAEALQVVVMEKMKQLLGDDPPTTLT
SMANLATTYWHQEQWKEAEELQVVVMEKMKQLLGDDHPDTLTSMANLASTYSNQWQWKEPEALDKGVVEKKRQLL
GDDHPDTLKSMANLAATYKNQGKWKEAEALYKVVMEKKRQLLGDDHPATLTSMANLANSYWYQEQWKEAEALQVV
VMEKMKRLLGDDHPTTLTSMANLATMYRDQRQWKEAEALQVAVIEKMKRLLGEAQGSRGASGPKNSLNCIISKFF
LCASVNENQILYNSGNIWAYTTRYSLILSVPPLKIYSRSKQNRAVMTCR*
Coding >AgabiH97|020470
ATGTCATCCAGGACAAGGAACTCGGGATCTCCATCAACGTTCTGGGCCTTTCGGTGTGAAAGTTTAGATGGACCA
CCTTTGAGGCTGCTTGCGCTAGATGGCGGTGGGATTCGCGGACTTTCAGAACTACTCATCATCAAGGAAGTTATG
CACAAGCTAATGTTTGAGGAGAACGAGAAACGGAAGCGGGACGGTGAAGAACCTCTTAGCGTACTCCCGAAGCCG
TGCGATTATTTCGATCTGATTGGTGGTACTGGTACTGGAGGGATAATTGCTTTAATGCTTGGGCGTCTTCGGATG
GATGTAGACACCGCAATCAAAATATACGATGACCTGGCAAAACGAGTCTTCTCCGCTATGAAGCGATGGGGGAAG
GGAAGATTCAAAGCGACAACACTCGAAGCAGCCATGAAATCTGTCGTGGAGACCGTAACTGGTGATTCCGAGTCA
CCCTTATTAGAAGCTGATCAAGCTGGAGTCTGCCGAACTTTCGTCTGCGCAAAGAGCGCCCACAACATGAACACC
CCAGTGCTTCTTAGGACATACCAGTCTCGTGAAACACATGTCAATTGCAAGATTTGGGAGGCCGCTCGAGCGACA
TCTGCAGCGCCCATATTTTTTAAGCGCATTGAGATCGGGCGGAACCAGCCCTTTATCGATGGTGGACTAGGCCGC
AATAATCCGAGTCAGGTGGTGCTGGAAGAAGCCAATGCTCTATTTGGCGCTCGTCAAATCGGGTGTTTGGTGAGC
ATTGGTACTGGACAGGCCGGAATAATCGGGATCAAGAAACCTGGGGTATGGCAGCGAAACATACCAAAAGCCGTC
ATCGATGCGTTAAGAGCAATCACCACCGACTGCGAATCAACACACGAAGTTATGTTGCACCGTTTCTCCTTTTTG
CCGTACACCTATTTTCGCGTAAATGTCGAGCAGGGGATGCAGAGACTAGAGCTTTCCGAATGGGAGAAACTAGAT
AATGTTAAGGCTCATACAATGCAGTATATGCAGAAGGAGGAGGTCGCTGAGAAGCTTGCCTTGTTGGTTAGTGCG
ATCAGAGTCCCGCGAGGGCAGCTTCTACTCGAGCAACTCGTTACTCCTAGGCATCCAAATGAATCGGTCCCACAA
GCCAGGGAACACAAGCGTTGTCCGCTTCCTGTGCAACCATTTATAGGACGAGAGGAAATCCTTGATCAGATGCGC
AAATATTTTGAGTTGGGGGGTGATTCCCCACGTGTCTTCGTTTTGCATGGCCTTGGGGGTTCCGGCAAGACCCAA
ATTGCTTTCAAATTTGTGCAAGAATCAACCTGCTTCTCCAACGTCTTCTACATTGACGCGACCAATGAACAAACT
CTTCGAACAGACCTTGAGGCCATCACTCCAGGAAATACGGAGCGATCAGTGGATGCGAGTCTCCATTGGCTTGCA
AGCCAGCGCGAGGGGAAGTGGCTTCTCGTCTTCGACCACGCGGACGGTGTGAACTTGAAACTGAAGAGATTCATT
CCTCAGTGTCGATTTGGAAACGTCCTGGTTACAACACGTAACCGAGACCTTCGCCATCTCTCTGCAAAAGACGGG
GATGCAAAAGTTGGTGCGATGGAGCACGAAGACGCAAAAAACCTGCTGCTGGATCGGGCTCGGGCAGAAGAGAGT
GATGAAAATAAAGTGCTGGCAGAGGCGATTGTAAAGGACCTCCATTACTTTGCTTTGGCTATTTCCCAAGCTGGC
GCTTACATTCATTGCCACTTGTCATTGAGCGAATATCGAGAATTCTATCGACGTCACCATGACAAACTGTTACAA
AATGAAGAGTTCCAAGGAGGGGATCCATACGATCGAGCGGTGTATGCGACGTGGAGTTTGAGCTACGACGAACTT
GACGCGTCAGCAAGATCTTTGCTCCAAATTTTCTCGGTGCTACATCACGAAGGAATATCGGAGGAGATGTTCGAA
AAGGCGGCATCGTCTGAAATGCAACTGGAGGATTCCGAACTACAACTCAAAGTGACTGAGTTGTTGAACATGTTG
GGAAAACGAGGTCCAGACTGGTCTTGGGACTTTAAGCAGGTCATCGCGCGTCTGATTTCATTTTCGCTCATTGAA
TATGATAATCAAAATCACACCTACAGCATTCATCCACTAGTGCAACAGTGGAGTTGTAGCACCATGGCGGGAAAT
AGACAGCTCATGCAGAAATGTGTACTCAGCATCATTTGCCTATCAATTTCTTCGTCGTTCGACCAGGACTACAAT
TATCGACATACACTTTTGCAGCATATCTCCAGCTCCAGAGCCTCGGTCGATCCAGGACAGTTGACGCCTTCAGTT
TTGAATGGTATGGCACTTGTATGCTTCGAACAGGGGCAGTGGAAGGAAGCAGAGGAGCTTTGGGTGGTGGCGATG
GAGAAGAGGAAGCGGCTGCTCAGTAATGATCATCCTGACACACTCATGAGCATGGCCAATCTTGCGCTCACGTAC
AGGGACCAGGGGCAGTGGAAGGAAGCAGAGGAGCTTCAGGTGGTGGTGATGGAGAAGACGAAGCAGCTGCTTGGT
GATGATCATCCCGACACACTCATGAGCATGGCCAATCTTGCGGCCACGTACAGGAACCAGGAGCAGTTGAAGAAA
GCAGAGGCGCTTCAGGTGGTGGTGATGGAGAAGATGAAGCAGCTGCTCGGTGATGATCCTCCTACCACACTCACG
AGCATGGCCAATCTTGCGACCACGTACTGGCACCAGGAGCAGTGGAAGGAAGCAGAGGAGCTTCAGGTGGTGGTG
ATGGAGAAGATGAAGCAGCTGCTTGGTGATGATCATCCTGACACACTCACGAGCATGGCCAATCTTGCATCCACG
TACTCGAACCAGTGGCAGTGGAAGGAACCAGAGGCGCTTGACAAGGGGGTGGTGGAGAAGAAGAGGCAGCTTCTT
GGTGACGATCATCCTGACACACTCAAGAGCATGGCCAATCTTGCGGCCACGTACAAGAACCAGGGGAAGTGGAAG
GAAGCAGAGGCGCTTTACAAGGTGGTGATGGAGAAGAAGAGGCAGCTGCTTGGTGATGATCATCCTGCCACACTC
ACGAGCATGGCCAATCTTGCAAATTCGTACTGGTACCAGGAGCAGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTG
GTAATGGAGAAGATGAAACGGCTGCTCGGTGATGATCATCCTACCACCCTTACGAGTATGGCCAATCTTGCGACC
ATGTACAGGGACCAGAGGCAGTGGAAGGAAGCAGAGGCGCTTCAGGTGGCGGTGATTGAGAAGATGAAGCGACTG
CTCGGGGAAGCGCAAGGAAGCAGAGGCGCTTCAGGCCCAAAAAATTCACTTAATTGTATAATTTCGAAATTCTTT
TTGTGCGCCTCGGTCAATGAGAATCAAATCTTGTACAACTCTGGTAATATCTGGGCATACACTACACGGTACTCC
CTAATTTTATCCGTTCCTCCGCTGAAAATTTATAGTCGAAGTAAACAGAATCGTGCAGTCATGACATGCCGGTAG
Transcript >AgabiH97|020470
ATGTCATCCAGGACAAGGAACTCGGGATCTCCATCAACGTTCTGGGCCTTTCGGTGTGAAAGTTTAGATGGACCA
CCTTTGAGGCTGCTTGCGCTAGATGGCGGTGGGATTCGCGGACTTTCAGAACTACTCATCATCAAGGAAGTTATG
CACAAGCTAATGTTTGAGGAGAACGAGAAACGGAAGCGGGACGGTGAAGAACCTCTTAGCGTACTCCCGAAGCCG
TGCGATTATTTCGATCTGATTGGTGGTACTGGTACTGGAGGGATAATTGCTTTAATGCTTGGGCGTCTTCGGATG
GATGTAGACACCGCAATCAAAATATACGATGACCTGGCAAAACGAGTCTTCTCCGCTATGAAGCGATGGGGGAAG
GGAAGATTCAAAGCGACAACACTCGAAGCAGCCATGAAATCTGTCGTGGAGACCGTAACTGGTGATTCCGAGTCA
CCCTTATTAGAAGCTGATCAAGCTGGAGTCTGCCGAACTTTCGTCTGCGCAAAGAGCGCCCACAACATGAACACC
CCAGTGCTTCTTAGGACATACCAGTCTCGTGAAACACATGTCAATTGCAAGATTTGGGAGGCCGCTCGAGCGACA
TCTGCAGCGCCCATATTTTTTAAGCGCATTGAGATCGGGCGGAACCAGCCCTTTATCGATGGTGGACTAGGCCGC
AATAATCCGAGTCAGGTGGTGCTGGAAGAAGCCAATGCTCTATTTGGCGCTCGTCAAATCGGGTGTTTGGTGAGC
ATTGGTACTGGACAGGCCGGAATAATCGGGATCAAGAAACCTGGGGTATGGCAGCGAAACATACCAAAAGCCGTC
ATCGATGCGTTAAGAGCAATCACCACCGACTGCGAATCAACACACGAAGTTATGTTGCACCGTTTCTCCTTTTTG
CCGTACACCTATTTTCGCGTAAATGTCGAGCAGGGGATGCAGAGACTAGAGCTTTCCGAATGGGAGAAACTAGAT
AATGTTAAGGCTCATACAATGCAGTATATGCAGAAGGAGGAGGTCGCTGAGAAGCTTGCCTTGTTGGTTAGTGCG
ATCAGAGTCCCGCGAGGGCAGCTTCTACTCGAGCAACTCGTTACTCCTAGGCATCCAAATGAATCGGTCCCACAA
GCCAGGGAACACAAGCGTTGTCCGCTTCCTGTGCAACCATTTATAGGACGAGAGGAAATCCTTGATCAGATGCGC
AAATATTTTGAGTTGGGGGGTGATTCCCCACGTGTCTTCGTTTTGCATGGCCTTGGGGGTTCCGGCAAGACCCAA
ATTGCTTTCAAATTTGTGCAAGAATCAACCTGCTTCTCCAACGTCTTCTACATTGACGCGACCAATGAACAAACT
CTTCGAACAGACCTTGAGGCCATCACTCCAGGAAATACGGAGCGATCAGTGGATGCGAGTCTCCATTGGCTTGCA
AGCCAGCGCGAGGGGAAGTGGCTTCTCGTCTTCGACCACGCGGACGGTGTGAACTTGAAACTGAAGAGATTCATT
CCTCAGTGTCGATTTGGAAACGTCCTGGTTACAACACGTAACCGAGACCTTCGCCATCTCTCTGCAAAAGACGGG
GATGCAAAAGTTGGTGCGATGGAGCACGAAGACGCAAAAAACCTGCTGCTGGATCGGGCTCGGGCAGAAGAGAGT
GATGAAAATAAAGTGCTGGCAGAGGCGATTGTAAAGGACCTCCATTACTTTGCTTTGGCTATTTCCCAAGCTGGC
GCTTACATTCATTGCCACTTGTCATTGAGCGAATATCGAGAATTCTATCGACGTCACCATGACAAACTGTTACAA
AATGAAGAGTTCCAAGGAGGGGATCCATACGATCGAGCGGTGTATGCGACGTGGAGTTTGAGCTACGACGAACTT
GACGCGTCAGCAAGATCTTTGCTCCAAATTTTCTCGGTGCTACATCACGAAGGAATATCGGAGGAGATGTTCGAA
AAGGCGGCATCGTCTGAAATGCAACTGGAGGATTCCGAACTACAACTCAAAGTGACTGAGTTGTTGAACATGTTG
GGAAAACGAGGTCCAGACTGGTCTTGGGACTTTAAGCAGGTCATCGCGCGTCTGATTTCATTTTCGCTCATTGAA
TATGATAATCAAAATCACACCTACAGCATTCATCCACTAGTGCAACAGTGGAGTTGTAGCACCATGGCGGGAAAT
AGACAGCTCATGCAGAAATGTGTACTCAGCATCATTTGCCTATCAATTTCTTCGTCGTTCGACCAGGACTACAAT
TATCGACATACACTTTTGCAGCATATCTCCAGCTCCAGAGCCTCGGTCGATCCAGGACAGTTGACGCCTTCAGTT
TTGAATGGTATGGCACTTGTATGCTTCGAACAGGGGCAGTGGAAGGAAGCAGAGGAGCTTTGGGTGGTGGCGATG
GAGAAGAGGAAGCGGCTGCTCAGTAATGATCATCCTGACACACTCATGAGCATGGCCAATCTTGCGCTCACGTAC
AGGGACCAGGGGCAGTGGAAGGAAGCAGAGGAGCTTCAGGTGGTGGTGATGGAGAAGACGAAGCAGCTGCTTGGT
GATGATCATCCCGACACACTCATGAGCATGGCCAATCTTGCGGCCACGTACAGGAACCAGGAGCAGTTGAAGAAA
GCAGAGGCGCTTCAGGTGGTGGTGATGGAGAAGATGAAGCAGCTGCTCGGTGATGATCCTCCTACCACACTCACG
AGCATGGCCAATCTTGCGACCACGTACTGGCACCAGGAGCAGTGGAAGGAAGCAGAGGAGCTTCAGGTGGTGGTG
ATGGAGAAGATGAAGCAGCTGCTTGGTGATGATCATCCTGACACACTCACGAGCATGGCCAATCTTGCATCCACG
TACTCGAACCAGTGGCAGTGGAAGGAACCAGAGGCGCTTGACAAGGGGGTGGTGGAGAAGAAGAGGCAGCTTCTT
GGTGACGATCATCCTGACACACTCAAGAGCATGGCCAATCTTGCGGCCACGTACAAGAACCAGGGGAAGTGGAAG
GAAGCAGAGGCGCTTTACAAGGTGGTGATGGAGAAGAAGAGGCAGCTGCTTGGTGATGATCATCCTGCCACACTC
ACGAGCATGGCCAATCTTGCAAATTCGTACTGGTACCAGGAGCAGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTG
GTAATGGAGAAGATGAAACGGCTGCTCGGTGATGATCATCCTACCACCCTTACGAGTATGGCCAATCTTGCGACC
ATGTACAGGGACCAGAGGCAGTGGAAGGAAGCAGAGGCGCTTCAGGTGGCGGTGATTGAGAAGATGAAGCGACTG
CTCGGGGAAGCGCAAGGAAGCAGAGGCGCTTCAGGCCCAAAAAATTCACTTAATTGTATAATTTCGAAATTCTTT
TTGTGCGCCTCGGTCAATGAGAATCAAATCTTGTACAACTCTGGTAATATCTGGGCATACACTACACGGTACTCC
CTAATTTTATCCGTTCCTCCGCTGAAAATTTATAGTCGAAGTAAACAGAATCGTGCAGTCATGACATGCCGGTAG
Gene >AgabiH97|020470
ATGTCATCCAGGACAAGGAACTCGGGATCTCCATCAACGTTCTGGGTCCTCCTTCGCTTCAGATAATTTCAATAA
CCACTGGCAGCTGTCGCAGCAAGCAGTACTAGGCCTTTCGGTGTGAAAGTTTAGGTGCGTGCATGCAGCATGTCA
TATGTCACACCCTCGAGGCTCAATCTTTACTCTTAACGATGACTTCTTATGCAGATGGACCACCTTTGAGGCTGC
TTGCGCTAGGTATATGCGTCCGCTTGCACCCTCTCACCGATAGAGACGCTGACTAGTAAACTCTGAACAGATGGC
GGTGGGATTCGCGGACTTTCAGAACTACTCATCATCAAGGAAGTTATGCACAAGCTAATGTTTGAGGAGAACGAG
AAACGGAAGCGGGACGGTGAAGAACCTCTTAGCGTACTCCCGAAGCCGTGCGATTATTTCGATCTGATTGGTGGT
ACTGGTACTGGAGGGTGCGTAGCGTTATACATCTACAGTTGTCTCATGTTACTCACATGTATATTACAGGATAAT
TGCTTTAATGCTTGGGCGTCTTCGGATGGATGTAGACACCGCAATCAAAATATACGATGACCTGGCAAAACGAGT
CTTCTCCGCTATGAAGCGATGGGGGAAGGGAAGATTCAAAGCGACAACACTCGAAGCAGCCATGAAATCTGTCGT
GGAGACCGTAACTGGTGATTCCGAGTCACCCTTATTAGAAGCTGATCAAGCTGGAGTCTGCCGAACGTGAGTATA
TTACTTACTCTTCCATGCATTTGGACTTTGAATTCGAAGATTTATTAGTTTCGTCTGCGCAAAGAGCGCCCACAA
CATGAACACCCCAGTGCTTCTTAGGACATACCAGTCTCGTGAAACACATGTCAATTGCAAGATTTGGGAGGCCGC
TCGAGCGACATCTGCAGCGCCCATATTTTTTAAGCGCATTGAGATCGGGCGGAACCAGCCCTTTATCGATGGTGG
ACTAGGCCGCAATAATCCGAGTCAGGTGGTGCTGGAAGAAGCCAATGCTCTATTTGGCGCTCGTCAAATCGGGTG
TTTGGTGAGCATTGGTACTGGACAGGCCGGAATAATCGGGATCAAGAAACCTGGGGTATGGCAGCGAAACATACC
AAAAGCCGTCATCGATGCGTTAAGAGCAATCACCACCGACTGCGAATCAACACACGAAGTTATGTTGCACCGTTT
CTCCTTTTTGCCGTACACCTATTTTCGCGTAAATGTCGAGCAGGGGATGCAGAGACTAGAGCTTTCCGAATGGGA
GAAACTAGATAATGTTAAGGCTCATACAATGCAGTATATGCAGAAGGAGGAGGTCGCTGAGAAGCTTGCCTTGTT
GGTTAGTGCGATCAGAGTCCCGCGAGGGCAGCTTCTACTCGAGCAACTCGGTATGGAAGAATCACTCTTGTAGAT
CTTCATAATAATCTAATCTCGTTACCCTAGTTACTCCTAGGCATCCAAATGAATCGGTCCCACAAGCCAGGGAAC
ACAAGCGTTGTCCGCTTCCTGTGCAACCATTTATAGGACGAGAGGAAATCCTTGATCAGATGCGCAAATATTTTG
AGTTGGGGGGTGATTCCCCACGTGTCTTCGTTTTGCATGGCCTTGGGGGTTCCGGCAAGACCCAAATTGCTTTCA
AATTTGTGCAAGAATCAACCTGGTATGATTCAACTCTCTACAAACTCGCGACTGGCGACAATTTATATGTTTAAT
TTCTAGCTTCTCCAACGTCTTCTACATTGACGCGACCAATGAACAAACTCTTCGAACAGACCTTGAGGCCATCAC
TCCAGGAAATACGGAGCGATCAGTGGATGCGAGTCTCCATTGGCTTGCAAGCCAGCGCGAGGGGAAGTGGCTTCT
CGTCTTCGACCACGCGGACGGTGTGAACTTGAAACTGAAGAGATTCATTCCTCAGTGTCGATTTGGAAACGTCCT
GGTTACAACACGTAACCGAGACCTTCGCCATCTCTCTGCAAAAGACGGGGATGCAAAAGTTGGTGCGATGGAGCA
CGAAGACGCAAAAAACCTGCTGCTGGATCGGGCTCGGGCAGAAGAGAGTGATGAAAATAAAGTGCTGGCAGAGGC
GATTGTAAAGGTTCTTCCTCTCATTTTGGTTTCTTTAAAATACATCTTCAGTCTAAAGCGCGAAACAGGACCTCC
ATTACTTTGCTTTGGCTATTTCCCAAGCTGGCGCTTACATTCATTGCCACTTGTCATTGAGCGAATATCGAGAAT
TCTATCGACGTCACCATGACAAACTGTTACAAAATGAAGAGTTCCAAGGAGGGGATCCATACGATCGAGCGGTGT
ATGCGACGTGGAGTTTGAGCTACGACGAACTTGACGCGTCAGCAAGATCTTTGCTCCAAATTTTCTCGGTGCTAC
ATCACGAAGGAATATCGGAGGAGATGTTCGAAAAGGCGGCATCGTCTGAAATGCAACTGGAGGATTCCGAACTAC
AACTCAAAGTGACTGAGTTGTTGAACATGTTGGGAAAACGAGGTCCAGACTGGTCTTGGGACTTTAAGCAGGTCA
TCGCGCGTCTGATTTCATTTTCGCTCATTGAATATGATAATCAAAATCACACCTACAGCATTCATCCACTAGTGC
AACAGTGGAGTTGTAGCACCATGGCGGGAAATAGACAGCTCATGCAGAAATGTGTACTCAGCATCATTTGCCTAT
CAATTTCTTCGTCGTTCGACCAGGACTACAATTATCGACATACACTTTTGCAGCATATCTCCAGCTCCAGAGCCT
CGGTCGATCCAGGACAGTTGACGCCTTCAGTTTTGAATGGTATGGCACTTGTATGCTTCGAACAGGGGCAGTGGA
AGGAAGCAGAGGAGCTTTGGGTGGTGGCGATGGAGAAGAGGAAGCGGCTGCTCAGTAATGATCATCCTGACACAC
TCATGAGCATGGCCAATCTTGCGCTCACGTACAGGGACCAGGGGCAGTGGAAGGAAGCAGAGGAGCTTCAGGTGG
TGGTGATGGAGAAGACGAAGCAGCTGCTTGGTGATGATCATCCCGACACACTCATGAGCATGGCCAATCTTGCGG
CCACGTACAGGAACCAGGAGCAGTTGAAGAAAGCAGAGGCGCTTCAGGTGGTGGTGATGGAGAAGATGAAGCAGC
TGCTCGGTGATGATCCTCCTACCACACTCACGAGCATGGCCAATCTTGCGACCACGTACTGGCACCAGGAGCAGT
GGAAGGAAGCAGAGGAGCTTCAGGTGGTGGTGATGGAGAAGATGAAGCAGCTGCTTGGTGATGATCATCCTGACA
CACTCACGAGCATGGCCAATCTTGCATCCACGTACTCGAACCAGTGGCAGTGGAAGGAACCAGAGGCGCTTGACA
AGGGGGTGGTGGAGAAGAAGAGGCAGCTTCTTGGTGACGATCATCCTGACACACTCAAGAGCATGGCCAATCTTG
CGGCCACGTACAAGAACCAGGGGAAGTGGAAGGAAGCAGAGGCGCTTTACAAGGTGGTGATGGAGAAGAAGAGGC
AGCTGCTTGGTGATGATCATCCTGCCACACTCACGAGCATGGCCAATCTTGCAAATTCGTACTGGTACCAGGAGC
AGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTGGTAATGGAGAAGATGAAACGGCTGCTCGGTGATGATCATCCTA
CCACCCTTACGAGTATGGCCAATCTTGCGACCATGTACAGGGACCAGAGGCAGTGGAAGGAAGCAGAGGCGCTTC
AGGTGGCGGTGATTGAGAAGATGAAGCGACTGCTCGGTGATGATCATTCTACCACCCTCATGAGCATGGGCAATC
TTCTGACCACATACAAGAACCAGGGGAAGCGCAAGGAAGCAGAGGCGCTTCAGGCGTTGATGAAGAAGAGGAAGC
AGTCACACTGTTAAGTTGAGGTTTTCGGCTCAGCCAAAAAATTCACTTAATTGTATAATTTCGGTACGCCACTGA
AAAGACAAATTTGACTGGCTCCTGAGTATGGATTCGACTTCAGAAATTCTTTTTGTGCGCCTCGGTCAATGAGAA
TCAAATCTTGTACAACTCTGGTAATATCTGGGCATACACTACACGGTACTCCCTAATTTTATCCGTTCCTCCGCT
GAAAATTTATAGGTAAGCCAATATGTCCACTCCGACACTCCATCATCTGAATCGACGAATTGAAATTCTACAAAT
GACGTTCCAGTCGAAGTAAACAGAATCGTGGTAGGCTGGTCCGGAGATCGGGTTTTCCAATCATCTAATTGTCGT
TCCAATCGTATACAGCAGTCATGACATGCCGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail