Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|020300
Gene name
Locationscaffold_10:1402093..1402796
Strand+
Gene length (bp)703
Transcript length (bp)531
Coding sequence length (bp)531
Protein length (aa) 177

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12296 HsbA Hydrophobic surface binding protein A 7.1E-29 21 146

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|020300
MQFKSFAYLLSAVAVVLAQSAQDVLSNLATLRTQLTTLDGAINGFPDTGGSLTQALAIHTDALNVQSATDDTTAA
TSGTPPFSEGEGQSVIDAVNGLVPIIEDALVGIVAKKPAFDALPLGGISNLVRQDLSGLSSSTSSLEDALIALAP
ADLVDESIALKNEVDAAFATAIAAYN*
Coding >AgabiH97|020300
ATGCAGTTCAAATCCTTTGCTTACCTCTTGTCCGCTGTTGCTGTAGTTCTTGCTCAAAGTGCGCAAGACGTCTTG
AGCAATCTCGCTACGTTAAGGACCCAGCTTACAACTCTGGACGGTGCGATCAATGGTTTCCCCGACACCGGAGGT
AGTTTGACCCAGGCATTGGCCATCCATACCGACGCACTCAATGTACAATCGGCCACCGATGATACCACCGCCGCT
ACCAGTGGTACCCCCCCCTTCTCCGAAGGTGAAGGCCAAAGCGTCATTGATGCTGTCAATGGCCTAGTACCAATC
ATCGAGGACGCGCTTGTGGGCATTGTAGCGAAGAAACCCGCCTTCGATGCTCTTCCGCTTGGTGGAATATCCAAT
CTCGTCAGGCAGGACCTTTCTGGTCTGTCTTCGAGTACTTCTAGTCTCGAGGACGCACTCATTGCACTTGCTCCT
GCTGATTTGGTTGATGAATCCATTGCTCTTAAGAATGAGGTTGACGCTGCGTTTGCAACTGCCATCGCGGCCTAC
AATTAA
Transcript >AgabiH97|020300
ATGCAGTTCAAATCCTTTGCTTACCTCTTGTCCGCTGTTGCTGTAGTTCTTGCTCAAAGTGCGCAAGACGTCTTG
AGCAATCTCGCTACGTTAAGGACCCAGCTTACAACTCTGGACGGTGCGATCAATGGTTTCCCCGACACCGGAGGT
AGTTTGACCCAGGCATTGGCCATCCATACCGACGCACTCAATGTACAATCGGCCACCGATGATACCACCGCCGCT
ACCAGTGGTACCCCCCCCTTCTCCGAAGGTGAAGGCCAAAGCGTCATTGATGCTGTCAATGGCCTAGTACCAATC
ATCGAGGACGCGCTTGTGGGCATTGTAGCGAAGAAACCCGCCTTCGATGCTCTTCCGCTTGGTGGAATATCCAAT
CTCGTCAGGCAGGACCTTTCTGGTCTGTCTTCGAGTACTTCTAGTCTCGAGGACGCACTCATTGCACTTGCTCCT
GCTGATTTGGTTGATGAATCCATTGCTCTTAAGAATGAGGTTGACGCTGCGTTTGCAACTGCCATCGCGGCCTAC
AATTAA
Gene >AgabiH97|020300
ATGCAGTTCAAATCCTTTGCTTACCTCTTGTCCGCTGTTGCTGTAGTTCTTGCTCAAAGTGCGCAAGACGTCTTG
AGCAATCTCGCTACGTTAAGGACCCAGCTTACAACTCTGGACGGTGCGATCAATGGTTTCCCCGACACCGGAGGT
AGTTTGACCCAGGCATTGGTCAGTAGACATTATTATGAATTTCGAAACATATGCTTGACCGTGACATGATTAACA
GGCCATCCATACCGACGCACTCAATGTACAATCGGCCACCGATGATACCACCGCCGCTACCAGTGTCAGTTTGTT
CAAATTCCATCTCTGACGAACATCGGGTCTAACATCTAATTTATCCTAGGGTACCCCCCCCTTCTCCGAAGGTGA
AGGCCAAAGCGTCATTGATGCTGTCAATGGCCTAGTACCAATCATCGAGGACGCGCTTGTGGGCATTGTAGCGAA
GAAACCCGCCTTCGATGCTCTTCCGCTTGGTGGAATATCCAATCTCGTCAGGCAGGACCTTTCTGGTCTGTCTTC
GAGTACTTCTAGTCTCGAGGACGCACTCATTGCACTTGCTCCTGTACGTCTTCGTCTCAAATTAGAAGGACTCGC
TCAAACAAAATTTTTTTACCAGGCTGATTTGGTTGATGAATCCATTGCTCTTAAGAATGAGGTTGACGCTGCGTT
TGCAACTGCCATCGCGGCCTACAATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail