Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|020230
Gene name
Locationscaffold_10:1381009..1381698
Strand+
Gene length (bp)689
Transcript length (bp)519
Coding sequence length (bp)519
Protein length (aa) 173

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12296 HsbA Hydrophobic surface binding protein A 2.5E-28 22 143

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 24.01 10.22 37.80
Initials Initials knots 31.84 15.30 48.38
Pileal_Stipeal_center Stage I stipe center 25.18 11.55 38.82
Pileal_Stipeal_shell Stage I stipe shell 25.60 11.82 39.38
DIF_stipe_center Stage II stipe center 25.24 11.69 38.79
DIF_stipe_shell Stage II stipe shell 20.86 9.40 32.31
DIF_stipe_skin Stage II stipe skin 23.92 10.80 37.04
DIF_cap_skin Stage II cap skin 20.14 9.05 31.24
DIF_cap_tissue Stage II cap tissue 22.56 10.32 34.81
DIF_gill_tissue Stage II gill tissue 24.97 11.56 38.37
YFB_stipe_center Young fruiting body stipe center 24.24 11.09 37.40
YFB_stipe_shell Young fruiting body stipe shell 16.66 7.22 26.10
YFB_stipe_skin Young fruiting body stipe skin 30.16 14.31 46.01
YFB_cap_skin Young fruiting body cap skin 22.17 10.02 34.32
YFB_cap_tissue Young fruiting body cap tissue 21.87 9.90 33.83
YFB_gill_tissue Young fruiting body gill tissue 18.77 8.21 29.34
YFB_veil Young fruiting body veil 25.81 11.88 39.74

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.957930 no
Casing YFB_stipe_center 0.989276 no
Casing YFB_stipe_shell 0.439825 no
Casing YFB_stipe_skin 0.663532 no
Casing YFB_cap_skin 0.909276 no
Casing YFB_cap_tissue 0.892318 no
Casing YFB_gill_tissue 0.656189 no
Casing YFB_veil 0.918522 no
Casing Initials 0.563533 no
Casing Pileal_Stipeal_center 0.947036 no
Casing Pileal_Stipeal_shell 0.929094 no
Casing DIF_stipe_center 0.946077 no
Casing DIF_stipe_shell 0.823610 no
Casing DIF_stipe_skin 0.995020 no
Casing DIF_cap_skin 0.768119 no
Casing DIF_cap_tissue 0.932573 no
DIF_gill_tissue YFB_stipe_center 0.968104 no
DIF_gill_tissue YFB_stipe_shell 0.375672 no
DIF_gill_tissue YFB_stipe_skin 0.733000 no
DIF_gill_tissue YFB_cap_skin 0.854387 no
DIF_gill_tissue YFB_cap_tissue 0.834678 no
DIF_gill_tissue YFB_gill_tissue 0.582808 no
DIF_gill_tissue YFB_veil 0.964116 no
YFB_stipe_center YFB_stipe_shell 0.418001 no
YFB_stipe_center YFB_stipe_skin 0.679274 no
YFB_stipe_center YFB_cap_skin 0.895202 no
YFB_stipe_center YFB_cap_tissue 0.876963 no
YFB_stipe_center YFB_gill_tissue 0.635021 no
YFB_stipe_center YFB_veil 0.930098 no
YFB_stipe_shell YFB_stipe_skin 0.132420 no
YFB_stipe_shell YFB_cap_skin 0.582920 no
YFB_stipe_shell YFB_cap_tissue 0.612338 no
YFB_stipe_shell YFB_gill_tissue 0.866629 no
YFB_stipe_shell YFB_veil 0.330826 no
YFB_stipe_skin YFB_cap_skin 0.509897 no
YFB_stipe_skin YFB_cap_tissue 0.485737 no
YFB_stipe_skin YFB_gill_tissue 0.259579 no
YFB_stipe_skin YFB_veil 0.789062 no
YFB_cap_skin YFB_cap_tissue 0.984605 no
YFB_cap_skin YFB_gill_tissue 0.791758 no
YFB_cap_skin YFB_veil 0.807896 no
YFB_cap_tissue YFB_gill_tissue 0.811015 no
YFB_cap_tissue YFB_veil 0.782579 no
YFB_gill_tissue YFB_veil 0.523377 no
Initials DIF_gill_tissue 0.631566 no
Initials YFB_stipe_center 0.576104 no
Initials YFB_stipe_shell 0.091161 no
Initials YFB_stipe_skin 0.936154 no
Initials YFB_cap_skin 0.407743 no
Initials YFB_cap_tissue 0.388941 no
Initials YFB_gill_tissue 0.191098 no
Initials YFB_veil 0.691606 no
Initials Pileal_Stipeal_center 0.648653 no
Initials Pileal_Stipeal_shell 0.676517 no
Initials DIF_stipe_center 0.650426 no
Initials DIF_stipe_shell 0.304591 no
Initials DIF_stipe_skin 0.543945 no
Initials DIF_cap_skin 0.252728 no
Initials DIF_cap_tissue 0.445290 no
Pileal_Stipeal_center DIF_gill_tissue 0.990604 no
Pileal_Stipeal_center YFB_stipe_center 0.958862 no
Pileal_Stipeal_center YFB_stipe_shell 0.359000 no
Pileal_Stipeal_center YFB_stipe_skin 0.746934 no
Pileal_Stipeal_center YFB_cap_skin 0.841417 no
Pileal_Stipeal_center YFB_cap_tissue 0.821079 no
Pileal_Stipeal_center YFB_gill_tissue 0.568374 no
Pileal_Stipeal_center YFB_veil 0.973747 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.982486 no
Pileal_Stipeal_center DIF_stipe_center 0.998072 no
Pileal_Stipeal_center DIF_stipe_shell 0.741242 no
Pileal_Stipeal_center DIF_stipe_skin 0.943343 no
Pileal_Stipeal_center DIF_cap_skin 0.680223 no
Pileal_Stipeal_center DIF_cap_tissue 0.869498 no
Pileal_Stipeal_shell DIF_gill_tissue 0.973674 no
Pileal_Stipeal_shell YFB_stipe_center 0.939583 no
Pileal_Stipeal_shell YFB_stipe_shell 0.338043 no
Pileal_Stipeal_shell YFB_stipe_skin 0.773189 no
Pileal_Stipeal_shell YFB_cap_skin 0.812897 no
Pileal_Stipeal_shell YFB_cap_tissue 0.793802 no
Pileal_Stipeal_shell YFB_gill_tissue 0.537362 no
Pileal_Stipeal_shell YFB_veil 0.990695 no
Pileal_Stipeal_shell DIF_stipe_center 0.984744 no
Pileal_Stipeal_shell DIF_stipe_shell 0.710849 no
Pileal_Stipeal_shell DIF_stipe_skin 0.922151 no
Pileal_Stipeal_shell DIF_cap_skin 0.647578 no
Pileal_Stipeal_shell DIF_cap_tissue 0.843759 no
DIF_stipe_center DIF_gill_tissue 0.988080 no
DIF_stipe_center YFB_stipe_center 0.955995 no
DIF_stipe_center YFB_stipe_shell 0.354472 no
DIF_stipe_center YFB_stipe_skin 0.749074 no
DIF_stipe_center YFB_cap_skin 0.838002 no
DIF_stipe_center YFB_cap_tissue 0.817080 no
DIF_stipe_center YFB_gill_tissue 0.562858 no
DIF_stipe_center YFB_veil 0.975558 no
DIF_stipe_center DIF_stipe_shell 0.736784 no
DIF_stipe_center DIF_stipe_skin 0.940101 no
DIF_stipe_center DIF_cap_skin 0.677527 no
DIF_stipe_center DIF_cap_tissue 0.866045 no
DIF_stipe_shell DIF_gill_tissue 0.760197 no
DIF_stipe_shell YFB_stipe_center 0.807090 no
DIF_stipe_shell YFB_stipe_shell 0.694846 no
DIF_stipe_shell YFB_stipe_skin 0.407139 no
DIF_stipe_shell YFB_cap_skin 0.932146 no
DIF_stipe_shell YFB_cap_tissue 0.948525 no
DIF_stipe_shell YFB_gill_tissue 0.878362 no
DIF_stipe_shell YFB_veil 0.701385 no
DIF_stipe_shell DIF_stipe_skin 0.823540 no
DIF_stipe_shell DIF_cap_skin 0.962892 no
DIF_stipe_shell DIF_cap_tissue 0.912124 no
DIF_stipe_skin DIF_gill_tissue 0.952164 no
DIF_stipe_skin YFB_stipe_center 0.984583 no
DIF_stipe_skin YFB_stipe_shell 0.441575 no
DIF_stipe_skin YFB_stipe_skin 0.650426 no
DIF_stipe_skin YFB_cap_skin 0.912444 no
DIF_stipe_skin YFB_cap_tissue 0.895893 no
DIF_stipe_skin YFB_gill_tissue 0.655821 no
DIF_stipe_skin YFB_veil 0.912148 no
DIF_stipe_skin DIF_cap_skin 0.768367 no
DIF_stipe_skin DIF_cap_tissue 0.935437 no
DIF_cap_skin DIF_gill_tissue 0.693586 no
DIF_cap_skin YFB_stipe_center 0.743381 no
DIF_cap_skin YFB_stipe_shell 0.745346 no
DIF_cap_skin YFB_stipe_skin 0.335873 no
DIF_cap_skin YFB_cap_skin 0.882752 no
DIF_cap_skin YFB_cap_tissue 0.904376 no
DIF_cap_skin YFB_gill_tissue 0.919535 no
DIF_cap_skin YFB_veil 0.631212 no
DIF_cap_skin DIF_cap_tissue 0.860145 no
DIF_cap_tissue DIF_gill_tissue 0.881089 no
DIF_cap_tissue YFB_stipe_center 0.919122 no
DIF_cap_tissue YFB_stipe_shell 0.545430 no
DIF_cap_tissue YFB_stipe_skin 0.541013 no
DIF_cap_tissue YFB_cap_skin 0.981380 no
DIF_cap_tissue YFB_cap_tissue 0.966270 no
DIF_cap_tissue YFB_gill_tissue 0.760262 no
DIF_cap_tissue YFB_veil 0.832213 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|020230
MQLKSLIFLGSAFTLVFGATTQDVLNDINTLRTRLNTLDSDLHSFSGGILDALAIHNAATSVQSATDDTTSDVQD
VPTPISEADAQSILDAITGIAPIIEDSLTTIVAKKSDFESVPLGGISIARGDLNNLAGSTSNLEDALIASTPADL
LDEANAIRNEIDAAFAAAIAAF*
Coding >AgabiH97|020230
ATGCAACTCAAGTCTCTTATCTTTCTTGGTTCCGCGTTCACTCTTGTCTTCGGAGCAACCACTCAAGATGTTTTG
AACGATATCAATACCCTCAGGACTCGTCTGAACACCTTGGATAGTGACCTCCATAGCTTTTCGGGTGGCATATTA
GATGCCTTGGCCATCCATAACGCTGCTACCAGTGTTCAATCCGCCACTGATGACACGACTAGCGATGTACAGGAT
GTTCCAACTCCCATTTCTGAAGCTGATGCTCAAAGCATTCTTGATGCTATCACTGGGATAGCACCCATTATTGAA
GATTCGCTCACGACAATCGTAGCCAAGAAGTCCGATTTCGAGTCTGTCCCCCTCGGTGGTATCAGCATCGCCAGG
GGTGATCTTAACAATCTTGCCGGGAGTACTTCTAACCTTGAGGATGCTCTTATTGCATCTACTCCTGCTGATTTA
CTTGATGAAGCCAATGCTATCAGGAATGAGATTGATGCTGCCTTTGCTGCTGCTATCGCAGCTTTTTAG
Transcript >AgabiH97|020230
ATGCAACTCAAGTCTCTTATCTTTCTTGGTTCCGCGTTCACTCTTGTCTTCGGAGCAACCACTCAAGATGTTTTG
AACGATATCAATACCCTCAGGACTCGTCTGAACACCTTGGATAGTGACCTCCATAGCTTTTCGGGTGGCATATTA
GATGCCTTGGCCATCCATAACGCTGCTACCAGTGTTCAATCCGCCACTGATGACACGACTAGCGATGTACAGGAT
GTTCCAACTCCCATTTCTGAAGCTGATGCTCAAAGCATTCTTGATGCTATCACTGGGATAGCACCCATTATTGAA
GATTCGCTCACGACAATCGTAGCCAAGAAGTCCGATTTCGAGTCTGTCCCCCTCGGTGGTATCAGCATCGCCAGG
GGTGATCTTAACAATCTTGCCGGGAGTACTTCTAACCTTGAGGATGCTCTTATTGCATCTACTCCTGCTGATTTA
CTTGATGAAGCCAATGCTATCAGGAATGAGATTGATGCTGCCTTTGCTGCTGCTATCGCAGCTTTTTAG
Gene >AgabiH97|020230
ATGCAACTCAAGTCTCTTATCTTTCTTGGTTCCGCGTTCACTCTTGTCTTCGGAGCAACCACTCAAGATGTTTTG
AACGATATCAATACCCTCAGGACTCGTCTGAACACCTTGGATAGTGACCTCCATAGCTTTTCGGGTGGCATATTA
GATGCCTTGGTTAGTTTTCCATTCTGATGAGAAAATCTGTACTTGATTAAGCGATTATTAGGCCATCCATAACGC
TGCTACCAGTGTTCAATCCGCCACTGATGACACGACTAGCGATGTACAGGTGAGCTTGTTTTGCACTATCAGTGT
TATTGCTGTAATCCGTTTCATTGACACGAGCAAGGATGTTCCAACTCCCATTTCTGAAGCTGATGCTCAAAGCAT
TCTTGATGCTATCACTGGGATAGCACCCATTATTGAAGATTCGCTCACGACAATCGTAGCCAAGAAGTCCGATTT
CGAGTCTGTCCCCCTCGGTGGTATCAGCATCGCCAGGGGTGATCTTAACAATCTTGCCGGGAGTACTTCTAACCT
TGAGGATGCTCTTATTGCATCTACTCCTGTAAGTCATCCTGCGCTGCGGTTTCTCAGTCTTTCGCTAAGCATTAC
GTTTTTCCTAGGCTGATTTACTTGATGAAGCCAATGCTATCAGGAATGAGATTGATGCTGCCTTTGCTGCTGCTA
TCGCAGCTTTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail