Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|020230
Gene name
Locationscaffold_10:1381009..1381698
Strand+
Gene length (bp)689
Transcript length (bp)519
Coding sequence length (bp)519
Protein length (aa) 173

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12296 HsbA Hydrophobic surface binding protein A 2.5E-28 22 143

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0971 0.0512 0.8824 0.0521 0.0331 0.0047 0.206 0.2208 0.0478 0.0026

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999755

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup2338
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|020230
Agaricus bisporus var bisporus H39 AgabiH39|020300
Agaricus bisporus var bisporus H97 AgabiH97|020230 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|020300

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|020230
MQLKSLIFLGSAFTLVFGATTQDVLNDINTLRTRLNTLDSDLHSFSGGILDALAIHNAATSVQSATDDTTSDVQD
VPTPISEADAQSILDAITGIAPIIEDSLTTIVAKKSDFESVPLGGISIARGDLNNLAGSTSNLEDALIASTPADL
LDEANAIRNEIDAAFAAAIAAF*
Coding >AgabiH97|020230
ATGCAACTCAAGTCTCTTATCTTTCTTGGTTCCGCGTTCACTCTTGTCTTCGGAGCAACCACTCAAGATGTTTTG
AACGATATCAATACCCTCAGGACTCGTCTGAACACCTTGGATAGTGACCTCCATAGCTTTTCGGGTGGCATATTA
GATGCCTTGGCCATCCATAACGCTGCTACCAGTGTTCAATCCGCCACTGATGACACGACTAGCGATGTACAGGAT
GTTCCAACTCCCATTTCTGAAGCTGATGCTCAAAGCATTCTTGATGCTATCACTGGGATAGCACCCATTATTGAA
GATTCGCTCACGACAATCGTAGCCAAGAAGTCCGATTTCGAGTCTGTCCCCCTCGGTGGTATCAGCATCGCCAGG
GGTGATCTTAACAATCTTGCCGGGAGTACTTCTAACCTTGAGGATGCTCTTATTGCATCTACTCCTGCTGATTTA
CTTGATGAAGCCAATGCTATCAGGAATGAGATTGATGCTGCCTTTGCTGCTGCTATCGCAGCTTTTTAG
Transcript >AgabiH97|020230
ATGCAACTCAAGTCTCTTATCTTTCTTGGTTCCGCGTTCACTCTTGTCTTCGGAGCAACCACTCAAGATGTTTTG
AACGATATCAATACCCTCAGGACTCGTCTGAACACCTTGGATAGTGACCTCCATAGCTTTTCGGGTGGCATATTA
GATGCCTTGGCCATCCATAACGCTGCTACCAGTGTTCAATCCGCCACTGATGACACGACTAGCGATGTACAGGAT
GTTCCAACTCCCATTTCTGAAGCTGATGCTCAAAGCATTCTTGATGCTATCACTGGGATAGCACCCATTATTGAA
GATTCGCTCACGACAATCGTAGCCAAGAAGTCCGATTTCGAGTCTGTCCCCCTCGGTGGTATCAGCATCGCCAGG
GGTGATCTTAACAATCTTGCCGGGAGTACTTCTAACCTTGAGGATGCTCTTATTGCATCTACTCCTGCTGATTTA
CTTGATGAAGCCAATGCTATCAGGAATGAGATTGATGCTGCCTTTGCTGCTGCTATCGCAGCTTTTTAG
Gene >AgabiH97|020230
ATGCAACTCAAGTCTCTTATCTTTCTTGGTTCCGCGTTCACTCTTGTCTTCGGAGCAACCACTCAAGATGTTTTG
AACGATATCAATACCCTCAGGACTCGTCTGAACACCTTGGATAGTGACCTCCATAGCTTTTCGGGTGGCATATTA
GATGCCTTGGTTAGTTTTCCATTCTGATGAGAAAATCTGTACTTGATTAAGCGATTATTAGGCCATCCATAACGC
TGCTACCAGTGTTCAATCCGCCACTGATGACACGACTAGCGATGTACAGGTGAGCTTGTTTTGCACTATCAGTGT
TATTGCTGTAATCCGTTTCATTGACACGAGCAAGGATGTTCCAACTCCCATTTCTGAAGCTGATGCTCAAAGCAT
TCTTGATGCTATCACTGGGATAGCACCCATTATTGAAGATTCGCTCACGACAATCGTAGCCAAGAAGTCCGATTT
CGAGTCTGTCCCCCTCGGTGGTATCAGCATCGCCAGGGGTGATCTTAACAATCTTGCCGGGAGTACTTCTAACCT
TGAGGATGCTCTTATTGCATCTACTCCTGTAAGTCATCCTGCGCTGCGGTTTCTCAGTCTTTCGCTAAGCATTAC
GTTTTTCCTAGGCTGATTTACTTGATGAAGCCAATGCTATCAGGAATGAGATTGATGCTGCCTTTGCTGCTGCTA
TCGCAGCTTTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail