Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|020100
Gene name
Locationscaffold_10:1348577..1349282
Strand+
Gene length (bp)705
Transcript length (bp)528
Coding sequence length (bp)528
Protein length (aa) 176

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 2.06 0.33 3.79
Initials Initials knots 6.08 2.10 10.06
Pileal_Stipeal_center Stage I stipe center 9.96 3.79 16.13
Pileal_Stipeal_shell Stage I stipe shell 12.09 4.68 19.50
DIF_stipe_center Stage II stipe center 5.52 1.54 9.49
DIF_stipe_shell Stage II stipe shell 8.84 3.36 14.33
DIF_stipe_skin Stage II stipe skin 8.61 2.90 14.33
DIF_cap_skin Stage II cap skin 12.12 4.90 19.33
DIF_cap_tissue Stage II cap tissue 6.54 2.12 10.97
DIF_gill_tissue Stage II gill tissue 6.11 2.11 10.12
YFB_stipe_center Young fruiting body stipe center 6.04 2.07 10.02
YFB_stipe_shell Young fruiting body stipe shell 7.87 2.87 12.86
YFB_stipe_skin Young fruiting body stipe skin 7.05 2.49 11.61
YFB_cap_skin Young fruiting body cap skin 2.84 0.64 5.05
YFB_cap_tissue Young fruiting body cap tissue 1.57 0.00 3.20
YFB_gill_tissue Young fruiting body gill tissue 4.30 1.26 7.34
YFB_veil Young fruiting body veil 3.24 0.81 5.67

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.036455 yes
Casing YFB_stipe_center 0.038495 yes
Casing YFB_stipe_shell 0.008791 yes
Casing YFB_stipe_skin 0.016669 yes
Casing YFB_cap_skin 0.684297 no
Casing YFB_cap_tissue 0.792561 no
Casing YFB_gill_tissue 0.198419 no
Casing YFB_veil 0.513336 no
Casing Initials 0.037140 yes
Casing Pileal_Stipeal_center 0.002951 yes
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.065649 no
Casing DIF_stipe_shell 0.005671 yes
Casing DIF_stipe_skin 0.006742 yes
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.027943 yes
DIF_gill_tissue YFB_stipe_center 0.988487 no
DIF_gill_tissue YFB_stipe_shell 0.696947 no
DIF_gill_tissue YFB_stipe_skin 0.847331 no
DIF_gill_tissue YFB_cap_skin 0.125287 no
DIF_gill_tissue YFB_cap_tissue 0.048834 yes
DIF_gill_tissue YFB_gill_tissue 0.562815 no
DIF_gill_tissue YFB_veil 0.224134 no
YFB_stipe_center YFB_stipe_shell 0.677355 no
YFB_stipe_center YFB_stipe_skin 0.832420 no
YFB_stipe_center YFB_cap_skin 0.130962 no
YFB_stipe_center YFB_cap_tissue 0.050908 no
YFB_stipe_center YFB_gill_tissue 0.577213 no
YFB_stipe_center YFB_veil 0.234746 no
YFB_stipe_shell YFB_stipe_skin 0.889465 no
YFB_stipe_shell YFB_cap_skin 0.032038 yes
YFB_stipe_shell YFB_cap_tissue 0.018344 yes
YFB_stipe_shell YFB_gill_tissue 0.231336 no
YFB_stipe_shell YFB_veil 0.061844 no
YFB_stipe_skin YFB_cap_skin 0.058926 no
YFB_stipe_skin YFB_cap_tissue 0.029890 yes
YFB_stipe_skin YFB_gill_tissue 0.356035 no
YFB_stipe_skin YFB_veil 0.112109 no
YFB_cap_skin YFB_cap_tissue 0.444357 no
YFB_cap_skin YFB_gill_tissue 0.512119 no
YFB_cap_skin YFB_veil 0.885659 no
YFB_cap_tissue YFB_gill_tissue 0.130530 no
YFB_cap_tissue YFB_veil 0.319878 no
YFB_gill_tissue YFB_veil 0.695606 no
Initials DIF_gill_tissue 0.995172 no
Initials YFB_stipe_center 0.995353 no
Initials YFB_stipe_shell 0.691647 no
Initials YFB_stipe_skin 0.843486 no
Initials YFB_cap_skin 0.127349 no
Initials YFB_cap_tissue 0.049882 yes
Initials YFB_gill_tissue 0.571443 no
Initials YFB_veil 0.226718 no
Initials Pileal_Stipeal_center 0.328878 no
Initials Pileal_Stipeal_shell 0.115194 no
Initials DIF_stipe_center 0.913393 no
Initials DIF_stipe_shell 0.485354 no
Initials DIF_stipe_skin 0.558964 no
Initials DIF_cap_skin 0.117477 no
Initials DIF_cap_tissue 0.933609 no
Pileal_Stipeal_center DIF_gill_tissue 0.340207 no
Pileal_Stipeal_center YFB_stipe_center 0.322789 no
Pileal_Stipeal_center YFB_stipe_shell 0.719104 no
Pileal_Stipeal_center YFB_stipe_skin 0.542210 no
Pileal_Stipeal_center YFB_cap_skin 0.004548 yes
Pileal_Stipeal_center YFB_cap_tissue 0.009446 yes
Pileal_Stipeal_center YFB_gill_tissue 0.061473 no
Pileal_Stipeal_center YFB_veil 0.012880 yes
Pileal_Stipeal_center Pileal_Stipeal_shell 0.772228 no
Pileal_Stipeal_center DIF_stipe_center 0.254541 no
Pileal_Stipeal_center DIF_stipe_shell 0.875057 no
Pileal_Stipeal_center DIF_stipe_skin 0.854805 no
Pileal_Stipeal_center DIF_cap_skin 0.771712 no
Pileal_Stipeal_center DIF_cap_tissue 0.452554 no
Pileal_Stipeal_shell DIF_gill_tissue 0.123958 no
Pileal_Stipeal_shell YFB_stipe_center 0.111025 no
Pileal_Stipeal_shell YFB_stipe_shell 0.395814 no
Pileal_Stipeal_shell YFB_stipe_skin 0.243944 no
Pileal_Stipeal_shell YFB_cap_skin 0.001140 yes
Pileal_Stipeal_shell YFB_cap_tissue 0.004548 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.016669 yes
Pileal_Stipeal_shell YFB_veil 0.003765 yes
Pileal_Stipeal_shell DIF_stipe_center 0.093175 no
Pileal_Stipeal_shell DIF_stipe_shell 0.561375 no
Pileal_Stipeal_shell DIF_stipe_skin 0.547396 no
Pileal_Stipeal_shell DIF_cap_skin 0.997305 no
Pileal_Stipeal_shell DIF_cap_tissue 0.190373 no
DIF_stipe_center DIF_gill_tissue 0.907126 no
DIF_stipe_center YFB_stipe_center 0.920059 no
DIF_stipe_center YFB_stipe_shell 0.574890 no
DIF_stipe_center YFB_stipe_skin 0.727263 no
DIF_stipe_center YFB_cap_skin 0.237666 no
DIF_stipe_center YFB_cap_tissue 0.070317 no
DIF_stipe_center YFB_gill_tissue 0.739359 no
DIF_stipe_center YFB_veil 0.376951 no
DIF_stipe_center DIF_stipe_shell 0.383711 no
DIF_stipe_center DIF_stipe_skin 0.451366 no
DIF_stipe_center DIF_cap_skin 0.094984 no
DIF_stipe_center DIF_cap_tissue 0.836615 no
DIF_stipe_shell DIF_gill_tissue 0.498303 no
DIF_stipe_shell YFB_stipe_center 0.480199 no
DIF_stipe_shell YFB_stipe_shell 0.879868 no
DIF_stipe_shell YFB_stipe_skin 0.722007 no
DIF_stipe_shell YFB_cap_skin 0.012880 yes
DIF_stipe_shell YFB_cap_tissue 0.012880 yes
DIF_stipe_shell YFB_gill_tissue 0.116118 no
DIF_stipe_shell YFB_veil 0.028193 yes
DIF_stipe_shell DIF_stipe_skin 0.976149 no
DIF_stipe_shell DIF_cap_skin 0.571670 no
DIF_stipe_shell DIF_cap_tissue 0.620054 no
DIF_stipe_skin DIF_gill_tissue 0.570149 no
DIF_stipe_skin YFB_stipe_center 0.554138 no
DIF_stipe_skin YFB_stipe_shell 0.915128 no
DIF_stipe_skin YFB_stipe_skin 0.775336 no
DIF_stipe_skin YFB_cap_skin 0.019987 yes
DIF_stipe_skin YFB_cap_tissue 0.014668 yes
DIF_stipe_skin YFB_gill_tissue 0.155040 no
DIF_stipe_skin YFB_veil 0.040723 yes
DIF_stipe_skin DIF_cap_skin 0.559424 no
DIF_stipe_skin DIF_cap_tissue 0.684255 no
DIF_cap_skin DIF_gill_tissue 0.117779 no
DIF_cap_skin YFB_stipe_center 0.107122 no
DIF_cap_skin YFB_stipe_shell 0.402033 no
DIF_cap_skin YFB_stipe_skin 0.244165 no
DIF_cap_skin YFB_cap_skin 0.001140 yes
DIF_cap_skin YFB_cap_tissue 0.004548 yes
DIF_cap_skin YFB_gill_tissue 0.016104 yes
DIF_cap_skin YFB_veil 0.003365 yes
DIF_cap_skin DIF_cap_tissue 0.184461 no
DIF_cap_tissue DIF_gill_tissue 0.939386 no
DIF_cap_tissue YFB_stipe_center 0.928471 no
DIF_cap_tissue YFB_stipe_shell 0.804398 no
DIF_cap_tissue YFB_stipe_skin 0.931811 no
DIF_cap_tissue YFB_cap_skin 0.099434 no
DIF_cap_tissue YFB_cap_tissue 0.038278 yes
DIF_cap_tissue YFB_gill_tissue 0.479522 no
DIF_cap_tissue YFB_veil 0.181690 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|020100
MVSFTSALILFTTLATTAIHVSANPNGALHELVARQTFDPSSVPQQCQDQCSALISSLTDATCGTDLSCVCGDSI
AEQTIDCAKCDAQIIGEDEAKALYDKYAAACKSGGIDVPSYDSSSSSSSNSNSNSNSNSGSSNGGNGASGDDNSP
NGASNLQMSAAGLAGTAALAFLLAA*
Coding >AgabiH97|020100
ATGGTCTCTTTCACCTCCGCTCTCATTCTCTTCACTACATTGGCTACGACAGCTATCCATGTTTCCGCTAACCCT
AATGGCGCCCTCCACGAGCTCGTTGCGCGTCAAACTTTCGATCCCAGCTCTGTCCCACAACAGTGTCAAGATCAA
TGTTCTGCGCTCATTTCTTCATTGACCGATGCAACTTGTGGTACTGACCTCAGTTGTGTTTGCGGTGACAGCATT
GCCGAACAAACCATAGACTGCGCAAAATGTGATGCGCAGATCATTGGTGAAGACGAGGCAAAGGCTCTCTACGAC
AAATATGCTGCTGCTTGCAAGTCTGGTGGTATTGATGTCCCGAGTTACGACTCGAGTTCGAGCTCGAGCTCGAAT
TCAAACTCAAACTCAAACTCAAATTCGGGTAGCAGCAACGGGGGCAACGGGGCCAGCGGCGATGATAACAGTCCC
AATGGTGCTTCCAACTTACAGATGTCTGCTGCTGGGCTAGCTGGTACTGCTGCTCTTGCTTTCCTCTTGGCTGCG
TGA
Transcript >AgabiH97|020100
ATGGTCTCTTTCACCTCCGCTCTCATTCTCTTCACTACATTGGCTACGACAGCTATCCATGTTTCCGCTAACCCT
AATGGCGCCCTCCACGAGCTCGTTGCGCGTCAAACTTTCGATCCCAGCTCTGTCCCACAACAGTGTCAAGATCAA
TGTTCTGCGCTCATTTCTTCATTGACCGATGCAACTTGTGGTACTGACCTCAGTTGTGTTTGCGGTGACAGCATT
GCCGAACAAACCATAGACTGCGCAAAATGTGATGCGCAGATCATTGGTGAAGACGAGGCAAAGGCTCTCTACGAC
AAATATGCTGCTGCTTGCAAGTCTGGTGGTATTGATGTCCCGAGTTACGACTCGAGTTCGAGCTCGAGCTCGAAT
TCAAACTCAAACTCAAACTCAAATTCGGGTAGCAGCAACGGGGGCAACGGGGCCAGCGGCGATGATAACAGTCCC
AATGGTGCTTCCAACTTACAGATGTCTGCTGCTGGGCTAGCTGGTACTGCTGCTCTTGCTTTCCTCTTGGCTGCG
TGA
Gene >AgabiH97|020100
ATGGTCTCTTTCACCTCCGCTCTCATTCTCTTCACTACATTGGCTACGACAGCTATCCATGGTACGAATTTTACG
TGCTGTGGAAATATGTATTGTGCTCAGATATTATACAGTTTCCGCTAACCCTAATGGCGCCCTCCACGAGCTCGT
TGCGCGTCAAACTTTCGATCCCAGCTCTGTCCCACAACAGTGTCAAGATCAATGTTCTGCGCTCATTTCTTCATT
GACCGATGCAGTGCGTCTCTAACTCTTACTTACGGTTTCATAATAAACTCATTCTGTCACCTTTGACTCTATAGA
CTTGTGGTACTGACCTCAGTTGTGTTTGCGGTGACAGCATTGCCGAACAAACCATAGACTGCGCAAAATGTGATG
CGCAGATCATTGGTGAAGACGAGGCAAAGGCTCTCTACGACAGTCAGTGTTTTCGTTTTTGTAGCTATGGTTTCA
AATCTGATTTAAATGGTTGATTTTCTAGAATATGCTGCTGCTTGCAAGTCTGGTGGTATTGATGTCCCGAGTTAC
GACTCGAGTTCGAGCTCGAGCTCGAATTCAAACTCAAACTCAAACTCAAATTCGGGTAGCAGCAACGGGGGCAAC
GGGGCCAGCGGCGATGATAACAGTCCCAATGGTGCTTCCAACTTACAGATGTCTGCTGCTGGGCTAGCTGGTACT
GCTGCTCTTGCTTTCCTCTTGGCTGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail