© 2023 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|020100 |
| Gene name | |
| Location | scaffold_10:1348577..1349282 |
| Strand | + |
| Gene length (bp) | 705 |
| Transcript length (bp) | 528 |
| Coding sequence length (bp) | 528 |
| Protein length (aa) | 176 |
| Localizations | Signals | Cytoplasm | Nucleus | Extracellular | Cell membrane | Mitochondrion | Plastid | Endoplasmic reticulum | Lysosome vacuole | Golgi apparatus | Peroxisome |
|---|---|---|---|---|---|---|---|---|---|---|---|
| Extracellular | 0.0633 | 0.0539 | 0.8441 | 0.2568 | 0.0782 | 0.0029 | 0.2049 | 0.1459 | 0.2072 | 0.0021 |
| SignalP signal predicted | Location | Score |
|---|---|---|
| Yes | 1 - 23 | 0.99975 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 2.06 | 0.33 | 3.79 |
| Initials | Initials knots | 6.08 | 2.10 | 10.06 |
| Pileal_Stipeal_center | Stage I stipe center | 9.96 | 3.79 | 16.13 |
| Pileal_Stipeal_shell | Stage I stipe shell | 12.09 | 4.68 | 19.50 |
| DIF_stipe_center | Stage II stipe center | 5.52 | 1.54 | 9.49 |
| DIF_stipe_shell | Stage II stipe shell | 8.84 | 3.36 | 14.33 |
| DIF_stipe_skin | Stage II stipe skin | 8.61 | 2.90 | 14.33 |
| DIF_cap_skin | Stage II cap skin | 12.12 | 4.90 | 19.33 |
| DIF_cap_tissue | Stage II cap tissue | 6.54 | 2.12 | 10.97 |
| DIF_gill_tissue | Stage II gill tissue | 6.11 | 2.11 | 10.12 |
| YFB_stipe_center | Young fruiting body stipe center | 6.04 | 2.07 | 10.02 |
| YFB_stipe_shell | Young fruiting body stipe shell | 7.87 | 2.87 | 12.86 |
| YFB_stipe_skin | Young fruiting body stipe skin | 7.05 | 2.49 | 11.61 |
| YFB_cap_skin | Young fruiting body cap skin | 2.84 | 0.64 | 5.05 |
| YFB_cap_tissue | Young fruiting body cap tissue | 1.57 | 0.00 | 3.20 |
| YFB_gill_tissue | Young fruiting body gill tissue | 4.30 | 1.26 | 7.34 |
| YFB_veil | Young fruiting body veil | 3.24 | 0.81 | 5.67 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.036455 | yes |
| Casing | YFB_stipe_center | 0.038495 | yes |
| Casing | YFB_stipe_shell | 0.008791 | yes |
| Casing | YFB_stipe_skin | 0.016669 | yes |
| Casing | YFB_cap_skin | 0.684297 | no |
| Casing | YFB_cap_tissue | 0.792561 | no |
| Casing | YFB_gill_tissue | 0.198419 | no |
| Casing | YFB_veil | 0.513336 | no |
| Casing | Initials | 0.037140 | yes |
| Casing | Pileal_Stipeal_center | 0.002951 | yes |
| Casing | Pileal_Stipeal_shell | 0.000613 | yes |
| Casing | DIF_stipe_center | 0.065649 | no |
| Casing | DIF_stipe_shell | 0.005671 | yes |
| Casing | DIF_stipe_skin | 0.006742 | yes |
| Casing | DIF_cap_skin | 0.000613 | yes |
| Casing | DIF_cap_tissue | 0.027943 | yes |
| DIF_gill_tissue | YFB_stipe_center | 0.988487 | no |
| DIF_gill_tissue | YFB_stipe_shell | 0.696947 | no |
| DIF_gill_tissue | YFB_stipe_skin | 0.847331 | no |
| DIF_gill_tissue | YFB_cap_skin | 0.125287 | no |
| DIF_gill_tissue | YFB_cap_tissue | 0.048834 | yes |
| DIF_gill_tissue | YFB_gill_tissue | 0.562815 | no |
| DIF_gill_tissue | YFB_veil | 0.224134 | no |
| YFB_stipe_center | YFB_stipe_shell | 0.677355 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.832420 | no |
| YFB_stipe_center | YFB_cap_skin | 0.130962 | no |
| YFB_stipe_center | YFB_cap_tissue | 0.050908 | no |
| YFB_stipe_center | YFB_gill_tissue | 0.577213 | no |
| YFB_stipe_center | YFB_veil | 0.234746 | no |
| YFB_stipe_shell | YFB_stipe_skin | 0.889465 | no |
| YFB_stipe_shell | YFB_cap_skin | 0.032038 | yes |
| YFB_stipe_shell | YFB_cap_tissue | 0.018344 | yes |
| YFB_stipe_shell | YFB_gill_tissue | 0.231336 | no |
| YFB_stipe_shell | YFB_veil | 0.061844 | no |
| YFB_stipe_skin | YFB_cap_skin | 0.058926 | no |
| YFB_stipe_skin | YFB_cap_tissue | 0.029890 | yes |
| YFB_stipe_skin | YFB_gill_tissue | 0.356035 | no |
| YFB_stipe_skin | YFB_veil | 0.112109 | no |
| YFB_cap_skin | YFB_cap_tissue | 0.444357 | no |
| YFB_cap_skin | YFB_gill_tissue | 0.512119 | no |
| YFB_cap_skin | YFB_veil | 0.885659 | no |
| YFB_cap_tissue | YFB_gill_tissue | 0.130530 | no |
| YFB_cap_tissue | YFB_veil | 0.319878 | no |
| YFB_gill_tissue | YFB_veil | 0.695606 | no |
| Initials | DIF_gill_tissue | 0.995172 | no |
| Initials | YFB_stipe_center | 0.995353 | no |
| Initials | YFB_stipe_shell | 0.691647 | no |
| Initials | YFB_stipe_skin | 0.843486 | no |
| Initials | YFB_cap_skin | 0.127349 | no |
| Initials | YFB_cap_tissue | 0.049882 | yes |
| Initials | YFB_gill_tissue | 0.571443 | no |
| Initials | YFB_veil | 0.226718 | no |
| Initials | Pileal_Stipeal_center | 0.328878 | no |
| Initials | Pileal_Stipeal_shell | 0.115194 | no |
| Initials | DIF_stipe_center | 0.913393 | no |
| Initials | DIF_stipe_shell | 0.485354 | no |
| Initials | DIF_stipe_skin | 0.558964 | no |
| Initials | DIF_cap_skin | 0.117477 | no |
| Initials | DIF_cap_tissue | 0.933609 | no |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.340207 | no |
| Pileal_Stipeal_center | YFB_stipe_center | 0.322789 | no |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.719104 | no |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.542210 | no |
| Pileal_Stipeal_center | YFB_cap_skin | 0.004548 | yes |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.009446 | yes |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.061473 | no |
| Pileal_Stipeal_center | YFB_veil | 0.012880 | yes |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.772228 | no |
| Pileal_Stipeal_center | DIF_stipe_center | 0.254541 | no |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.875057 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.854805 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.771712 | no |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.452554 | no |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.123958 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.111025 | no |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.395814 | no |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.243944 | no |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.001140 | yes |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.004548 | yes |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.016669 | yes |
| Pileal_Stipeal_shell | YFB_veil | 0.003765 | yes |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.093175 | no |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.561375 | no |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.547396 | no |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.997305 | no |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.190373 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.907126 | no |
| DIF_stipe_center | YFB_stipe_center | 0.920059 | no |
| DIF_stipe_center | YFB_stipe_shell | 0.574890 | no |
| DIF_stipe_center | YFB_stipe_skin | 0.727263 | no |
| DIF_stipe_center | YFB_cap_skin | 0.237666 | no |
| DIF_stipe_center | YFB_cap_tissue | 0.070317 | no |
| DIF_stipe_center | YFB_gill_tissue | 0.739359 | no |
| DIF_stipe_center | YFB_veil | 0.376951 | no |
| DIF_stipe_center | DIF_stipe_shell | 0.383711 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.451366 | no |
| DIF_stipe_center | DIF_cap_skin | 0.094984 | no |
| DIF_stipe_center | DIF_cap_tissue | 0.836615 | no |
| DIF_stipe_shell | DIF_gill_tissue | 0.498303 | no |
| DIF_stipe_shell | YFB_stipe_center | 0.480199 | no |
| DIF_stipe_shell | YFB_stipe_shell | 0.879868 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.722007 | no |
| DIF_stipe_shell | YFB_cap_skin | 0.012880 | yes |
| DIF_stipe_shell | YFB_cap_tissue | 0.012880 | yes |
| DIF_stipe_shell | YFB_gill_tissue | 0.116118 | no |
| DIF_stipe_shell | YFB_veil | 0.028193 | yes |
| DIF_stipe_shell | DIF_stipe_skin | 0.976149 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.571670 | no |
| DIF_stipe_shell | DIF_cap_tissue | 0.620054 | no |
| DIF_stipe_skin | DIF_gill_tissue | 0.570149 | no |
| DIF_stipe_skin | YFB_stipe_center | 0.554138 | no |
| DIF_stipe_skin | YFB_stipe_shell | 0.915128 | no |
| DIF_stipe_skin | YFB_stipe_skin | 0.775336 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.019987 | yes |
| DIF_stipe_skin | YFB_cap_tissue | 0.014668 | yes |
| DIF_stipe_skin | YFB_gill_tissue | 0.155040 | no |
| DIF_stipe_skin | YFB_veil | 0.040723 | yes |
| DIF_stipe_skin | DIF_cap_skin | 0.559424 | no |
| DIF_stipe_skin | DIF_cap_tissue | 0.684255 | no |
| DIF_cap_skin | DIF_gill_tissue | 0.117779 | no |
| DIF_cap_skin | YFB_stipe_center | 0.107122 | no |
| DIF_cap_skin | YFB_stipe_shell | 0.402033 | no |
| DIF_cap_skin | YFB_stipe_skin | 0.244165 | no |
| DIF_cap_skin | YFB_cap_skin | 0.001140 | yes |
| DIF_cap_skin | YFB_cap_tissue | 0.004548 | yes |
| DIF_cap_skin | YFB_gill_tissue | 0.016104 | yes |
| DIF_cap_skin | YFB_veil | 0.003365 | yes |
| DIF_cap_skin | DIF_cap_tissue | 0.184461 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.939386 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.928471 | no |
| DIF_cap_tissue | YFB_stipe_shell | 0.804398 | no |
| DIF_cap_tissue | YFB_stipe_skin | 0.931811 | no |
| DIF_cap_tissue | YFB_cap_skin | 0.099434 | no |
| DIF_cap_tissue | YFB_cap_tissue | 0.038278 | yes |
| DIF_cap_tissue | YFB_gill_tissue | 0.479522 | no |
| DIF_cap_tissue | YFB_veil | 0.181690 | no |
| Orthofinder run ID | 1 |
| Orthogroup | 1391 |
| Change Orthofinder run |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|020100 MVSFTSALILFTTLATTAIHVSANPNGALHELVARQTFDPSSVPQQCQDQCSALISSLTDATCGTDLSCVCGDSI AEQTIDCAKCDAQIIGEDEAKALYDKYAAACKSGGIDVPSYDSSSSSSSNSNSNSNSNSGSSNGGNGASGDDNSP NGASNLQMSAAGLAGTAALAFLLAA* |
| Coding | >AgabiH97|020100 ATGGTCTCTTTCACCTCCGCTCTCATTCTCTTCACTACATTGGCTACGACAGCTATCCATGTTTCCGCTAACCCT AATGGCGCCCTCCACGAGCTCGTTGCGCGTCAAACTTTCGATCCCAGCTCTGTCCCACAACAGTGTCAAGATCAA TGTTCTGCGCTCATTTCTTCATTGACCGATGCAACTTGTGGTACTGACCTCAGTTGTGTTTGCGGTGACAGCATT GCCGAACAAACCATAGACTGCGCAAAATGTGATGCGCAGATCATTGGTGAAGACGAGGCAAAGGCTCTCTACGAC AAATATGCTGCTGCTTGCAAGTCTGGTGGTATTGATGTCCCGAGTTACGACTCGAGTTCGAGCTCGAGCTCGAAT TCAAACTCAAACTCAAACTCAAATTCGGGTAGCAGCAACGGGGGCAACGGGGCCAGCGGCGATGATAACAGTCCC AATGGTGCTTCCAACTTACAGATGTCTGCTGCTGGGCTAGCTGGTACTGCTGCTCTTGCTTTCCTCTTGGCTGCG TGA |
| Transcript | >AgabiH97|020100 ATGGTCTCTTTCACCTCCGCTCTCATTCTCTTCACTACATTGGCTACGACAGCTATCCATGTTTCCGCTAACCCT AATGGCGCCCTCCACGAGCTCGTTGCGCGTCAAACTTTCGATCCCAGCTCTGTCCCACAACAGTGTCAAGATCAA TGTTCTGCGCTCATTTCTTCATTGACCGATGCAACTTGTGGTACTGACCTCAGTTGTGTTTGCGGTGACAGCATT GCCGAACAAACCATAGACTGCGCAAAATGTGATGCGCAGATCATTGGTGAAGACGAGGCAAAGGCTCTCTACGAC AAATATGCTGCTGCTTGCAAGTCTGGTGGTATTGATGTCCCGAGTTACGACTCGAGTTCGAGCTCGAGCTCGAAT TCAAACTCAAACTCAAACTCAAATTCGGGTAGCAGCAACGGGGGCAACGGGGCCAGCGGCGATGATAACAGTCCC AATGGTGCTTCCAACTTACAGATGTCTGCTGCTGGGCTAGCTGGTACTGCTGCTCTTGCTTTCCTCTTGGCTGCG TGA |
| Gene | >AgabiH97|020100 ATGGTCTCTTTCACCTCCGCTCTCATTCTCTTCACTACATTGGCTACGACAGCTATCCATGGTACGAATTTTACG TGCTGTGGAAATATGTATTGTGCTCAGATATTATACAGTTTCCGCTAACCCTAATGGCGCCCTCCACGAGCTCGT TGCGCGTCAAACTTTCGATCCCAGCTCTGTCCCACAACAGTGTCAAGATCAATGTTCTGCGCTCATTTCTTCATT GACCGATGCAGTGCGTCTCTAACTCTTACTTACGGTTTCATAATAAACTCATTCTGTCACCTTTGACTCTATAGA CTTGTGGTACTGACCTCAGTTGTGTTTGCGGTGACAGCATTGCCGAACAAACCATAGACTGCGCAAAATGTGATG CGCAGATCATTGGTGAAGACGAGGCAAAGGCTCTCTACGACAGTCAGTGTTTTCGTTTTTGTAGCTATGGTTTCA AATCTGATTTAAATGGTTGATTTTCTAGAATATGCTGCTGCTTGCAAGTCTGGTGGTATTGATGTCCCGAGTTAC GACTCGAGTTCGAGCTCGAGCTCGAATTCAAACTCAAACTCAAACTCAAATTCGGGTAGCAGCAACGGGGGCAAC GGGGCCAGCGGCGATGATAACAGTCCCAATGGTGCTTCCAACTTACAGATGTCTGCTGCTGGGCTAGCTGGTACT GCTGCTCTTGCTTTCCTCTTGGCTGCGTGA |