Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|019780
Gene name
Locationscaffold_10:1271253..1272999
Strand+
Gene length (bp)1746
Transcript length (bp)1146
Coding sequence length (bp)1146
Protein length (aa) 382

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01263 Aldose_epim Aldose 1-epimerase 6.8E-51 36 374

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AMB9|GALM_ARTBC Probable aldose 1-epimerase ARB_05372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05372 PE=1 SV=1 25 377 3.0E-52
sp|Q5EA79|GALM_BOVIN Aldose 1-epimerase OS=Bos taurus GN=GALM PE=2 SV=1 38 378 6.0E-43
sp|Q9GKX6|GALM_PIG Aldose 1-epimerase OS=Sus scrofa GN=GALM PE=2 SV=1 19 378 2.0E-42
sp|Q66HG4|GALM_RAT Aldose 1-epimerase OS=Rattus norvegicus GN=Galm PE=1 SV=1 43 378 2.0E-40
sp|Q8K157|GALM_MOUSE Aldose 1-epimerase OS=Mus musculus GN=Galm PE=1 SV=1 43 378 2.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AMB9|GALM_ARTBC Probable aldose 1-epimerase ARB_05372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05372 PE=1 SV=1 25 377 3.0E-52
sp|Q5EA79|GALM_BOVIN Aldose 1-epimerase OS=Bos taurus GN=GALM PE=2 SV=1 38 378 6.0E-43
sp|Q9GKX6|GALM_PIG Aldose 1-epimerase OS=Sus scrofa GN=GALM PE=2 SV=1 19 378 2.0E-42
sp|Q66HG4|GALM_RAT Aldose 1-epimerase OS=Rattus norvegicus GN=Galm PE=1 SV=1 43 378 2.0E-40
sp|Q8K157|GALM_MOUSE Aldose 1-epimerase OS=Mus musculus GN=Galm PE=1 SV=1 43 378 2.0E-40
sp|Q96C23|GALM_HUMAN Aldose 1-epimerase OS=Homo sapiens GN=GALM PE=1 SV=1 11 378 1.0E-39
sp|Q5R8U1|GALM_PONAB Aldose 1-epimerase OS=Pongo abelii GN=GALM PE=2 SV=1 38 378 2.0E-39
sp|P05149|GALM_ACICA Aldose 1-epimerase OS=Acinetobacter calcoaceticus GN=mro PE=1 SV=1 38 378 5.0E-35
sp|P0A9C3|GALM_ECOLI Aldose 1-epimerase OS=Escherichia coli (strain K12) GN=galM PE=1 SV=1 23 376 3.0E-31
sp|P0A9C4|GALM_SHIFL Aldose 1-epimerase OS=Shigella flexneri GN=galM PE=3 SV=1 23 376 3.0E-31
sp|P31765|GALM_HAEIN Aldose 1-epimerase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=galM PE=3 SV=2 26 377 2.0E-24
sp|P04397|GAL10_YEAST Bifunctional protein GAL10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL10 PE=1 SV=2 39 377 3.0E-21
sp|P53757|YN9A_YEAST Uncharacterized isomerase YNR071C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNR071C PE=1 SV=1 39 378 2.0E-16
sp|P09609|GAL10_KLULA Bifunctional protein GAL10 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GAL10 PE=2 SV=2 37 376 4.0E-15
sp|P38893|YH10_YEAST Uncharacterized isomerase YHR210C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHR210C PE=3 SV=1 20 378 6.0E-12
sp|Q9HDU3|GAL10_SCHPO Bifunctional protein gal10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gal10 PE=3 SV=1 61 378 1.0E-10
sp|P21955|GALM_STRTR Aldose 1-epimerase OS=Streptococcus thermophilus GN=galM PE=3 SV=1 27 252 4.0E-09
sp|P40801|GAL10_PACTA Bifunctional protein GAL10 OS=Pachysolen tannophilus GN=GAL10 PE=2 SV=1 60 370 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016853 isomerase activity Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|019780
MKGFIQLISTLACITLAAANVPGWPFDVTEINAPDGSVKAKFVSLGATMTELWVKDRDGNARDVILGYDDNTLLL
TDPDHPVFNAIVGRYANRIKNGTFSIPTTKEAQPPGTGVWQLPTNDHDGQVTLHSSDYGWDRKNWTVHSRSPTSV
TYKYVDPAGEDGQGFPGEVTVYATHEVSNGVLRSSVRAHATEKTPIMTTQHVYWNLDAFQNGGDTALNHYLTLDA
SRIVHLDGNAIPYGDFIETSGTIFDFKNGKMIGENFNQTVDNCGTGCQGFDHCWIYDQSETRRAGTSLWSNNSGI
RVDISTNQPAVQMYTAYWLNTPRKEVHGGPSLVYDSWSAVAIEQQGYVDAVNTPEWNVNQIYGPREDYEWSATYK
FSIVDA*
Coding >AgabiH97|019780
ATGAAAGGTTTTATTCAATTGATCTCCACTCTAGCTTGTATCACACTAGCCGCTGCGAATGTGCCAGGTTGGCCA
TTTGACGTGACCGAAATCAATGCTCCCGATGGCTCTGTCAAAGCAAAATTTGTTTCTCTCGGCGCAACTATGACC
GAACTCTGGGTTAAAGACAGGGATGGGAATGCCCGAGATGTCATTCTAGGATATGATGATAATACTCTGCTTTTA
ACCGACCCTGACCACCCAGTGTTCAATGCTATCGTGGGAAGATATGCTAACCGCATTAAAAACGGAACCTTCTCT
ATCCCAACTACAAAGGAAGCTCAGCCACCTGGCACCGGAGTTTGGCAGCTCCCTACCAACGACCATGATGGTCAG
GTTACGCTCCATAGCAGCGATTATGGCTGGGATAGGAAGAATTGGACAGTCCATTCACGTTCACCTACCAGTGTC
ACGTACAAATACGTGGATCCAGCAGGCGAGGATGGCCAAGGTTTCCCGGGAGAGGTGACCGTATACGCCACTCAT
GAAGTATCCAATGGCGTGCTTAGGTCCAGTGTCCGCGCCCATGCCACAGAAAAGACCCCGATTATGACTACGCAA
CACGTTTACTGGAACCTTGACGCCTTCCAGAATGGCGGGGACACTGCGCTTAACCACTACCTCACTCTTGACGCC
TCCAGGATTGTCCACCTTGATGGAAACGCTATTCCTTACGGCGATTTTATTGAAACTTCCGGTACCATTTTCGAC
TTCAAGAACGGGAAAATGATTGGTGAGAACTTTAATCAAACAGTTGATAACTGTGGAACGGGCTGCCAAGGGTTT
GATCACTGTTGGATCTATGATCAAAGTGAAACCAGACGTGCTGGAACGTCCTTGTGGAGCAATAACTCTGGTATC
AGGGTCGATATCTCTACAAATCAGCCAGCGGTTCAAATGTATACCGCTTACTGGCTCAACACCCCTCGGAAGGAA
GTCCACGGAGGCCCCTCTCTTGTATATGACTCCTGGTCGGCAGTAGCAATCGAGCAACAAGGATACGTTGATGCT
GTCAACACCCCGGAATGGAATGTTAACCAAATCTACGGACCACGTGAAGACTATGAGTGGAGCGCCACGTATAAG
TTTTCTATTGTGGATGCCTGA
Transcript >AgabiH97|019780
ATGAAAGGTTTTATTCAATTGATCTCCACTCTAGCTTGTATCACACTAGCCGCTGCGAATGTGCCAGGTTGGCCA
TTTGACGTGACCGAAATCAATGCTCCCGATGGCTCTGTCAAAGCAAAATTTGTTTCTCTCGGCGCAACTATGACC
GAACTCTGGGTTAAAGACAGGGATGGGAATGCCCGAGATGTCATTCTAGGATATGATGATAATACTCTGCTTTTA
ACCGACCCTGACCACCCAGTGTTCAATGCTATCGTGGGAAGATATGCTAACCGCATTAAAAACGGAACCTTCTCT
ATCCCAACTACAAAGGAAGCTCAGCCACCTGGCACCGGAGTTTGGCAGCTCCCTACCAACGACCATGATGGTCAG
GTTACGCTCCATAGCAGCGATTATGGCTGGGATAGGAAGAATTGGACAGTCCATTCACGTTCACCTACCAGTGTC
ACGTACAAATACGTGGATCCAGCAGGCGAGGATGGCCAAGGTTTCCCGGGAGAGGTGACCGTATACGCCACTCAT
GAAGTATCCAATGGCGTGCTTAGGTCCAGTGTCCGCGCCCATGCCACAGAAAAGACCCCGATTATGACTACGCAA
CACGTTTACTGGAACCTTGACGCCTTCCAGAATGGCGGGGACACTGCGCTTAACCACTACCTCACTCTTGACGCC
TCCAGGATTGTCCACCTTGATGGAAACGCTATTCCTTACGGCGATTTTATTGAAACTTCCGGTACCATTTTCGAC
TTCAAGAACGGGAAAATGATTGGTGAGAACTTTAATCAAACAGTTGATAACTGTGGAACGGGCTGCCAAGGGTTT
GATCACTGTTGGATCTATGATCAAAGTGAAACCAGACGTGCTGGAACGTCCTTGTGGAGCAATAACTCTGGTATC
AGGGTCGATATCTCTACAAATCAGCCAGCGGTTCAAATGTATACCGCTTACTGGCTCAACACCCCTCGGAAGGAA
GTCCACGGAGGCCCCTCTCTTGTATATGACTCCTGGTCGGCAGTAGCAATCGAGCAACAAGGATACGTTGATGCT
GTCAACACCCCGGAATGGAATGTTAACCAAATCTACGGACCACGTGAAGACTATGAGTGGAGCGCCACGTATAAG
TTTTCTATTGTGGATGCCTGA
Gene >AgabiH97|019780
ATGAAAGGTTTTATTCAATTGATCTCCACTCTAGCTTGTATCACACTAGCCGCTGCGAATGTGCCAGGTTGGGTG
CGTATTTACATGTTTCTTCTATTTTCTCAGACTGAGAAACGGTGCTTTTTAGCCATTTGACGTGACCGAAATCAA
TGCTCCCGATGGCTCTGTCAAAGCAAAATTTGTTTCTCTCGGCGCAACTATGACCGAACTCTGGGTTAAAGACAG
GGATGGGAATGCCCGAGATGTCATTCTAGGATATGATGATAATGTTCGTTCTTCTCTACCCGCCTTCTATGTTGT
TTTATGAGGCATATCACAGACTCTGCTTTTAACCGACCCTGACCACCCAGTGTTCAATGCTATCGTGGGAAGATA
TGCTAACCGCATTAAAAACGGTGTGTATTCAGTTCTTTTGCCCCGCTGTCACAGTTCAACTCATACAGTAATGAA
CAGGAACCTTCTCTATCCCAACTACAAAGGAAGCTCAGCCACCTGGCACCGGAGTTTGGCAGCTCCCTACCAACG
ACCATGATGGTGAGCCAGTCTTAGTTCTATCGATGTTATTCTAATACCATATGTCACTAGGTCAGGTAGGCACCA
GTCCCTCATGTCCCTGCCGAGCCACGCGAATTCATATGCTTTAGGTTACGCTCCATAGCAGCGATTATGGCTGGG
ATAGGAAGAATTGGACAGTCCATTCACGTTCACCTACCAGTGTCACGTACAAATACGTGGATCCAGCAGGCGAGG
ATGGCCAAGGTTTCCCGGGAGAGGTGACCGTATACGTGAGCCCTGACCATACATTTGCTGGGAAAGCTGCGTTAA
TCTGCTCTGTTAGGCCACTCATGAAGTATCCAATGGCGTGCTTAGGTCCAGTGTCCGCGCCCATGCCACAGAAAA
GGTTTGTCTCTCACTAGTACTCTAATTCATACCCTGAATTGTATAAACAGACCCCGATTATGACTACGCAACACG
TTTACTGGTTAGTCTCCTATTTTCTTGGAAGGAAGCAAGGACAGAGCTTGATCCAACTTTGTTGCAGGAACCTTG
ACGCCTTCCAGAATGGCGGGGACACTGCGCTTAACCACTACCTCACTCTTGACGCCTCCAGGATTGTCCACCTTG
ATGGAAACGCTATTCCTTACGGCGATTTTATTGAAACTTCCGGTACCATTTTCGACTTCAAGAACGGGAAAATGA
TTGGTGAGAACTTTAATCAAACAGTTGATAACTGTGGAACGGGTTTGTCGACTTTTTTTCCATCCTTTAGGCTAG
GTAAACTGATACATACACTCTTCAGGCTGCCAAGGGTTTGATCACTGTTGGATCTATGATCAAAGTGAAACCAGA
CGTGCTGGAACGTCCTTGTGGAGCAATAACTCTGGTATCAGGTGGGTTTCTTATATAGTATATTCAGCCCAGTCA
CCTATGTACTCATCATTCGTTGAATAGGGTCGATATCTCTACAAATCAGCCAGCGGTTCAAATGTATACCGCTTA
CTGGCTCAACACCCCTCGGAAGGAAGTCCACGGAGGCCCCTCTCTTGTATATGACTCCTGGTCGGCAGTAGCAAT
CGAGCAACAAGGATACGTTGATGCTGTCAACACCCCGGAATGGAATGTTAACCAAATCTGTGAGTTTTTGGTCAT
CCAGCTTGCTAGCATATCACTGAGATAATTGTAGACGGACCACGTGAAGACTATGAGTGGAGCGCCACGTATAAG
TTTTCTATTGTGGATGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail