Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|019760
Gene name
Locationscaffold_10:1268580..1270441
Strand-
Gene length (bp)1861
Transcript length (bp)1569
Coding sequence length (bp)1569
Protein length (aa) 523

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 24.56 13.14 35.99
Initials Initials knots 29.32 16.90 41.73
Pileal_Stipeal_center Stage I stipe center 10.22 5.16 15.28
Pileal_Stipeal_shell Stage I stipe shell 9.60 4.76 14.44
DIF_stipe_center Stage II stipe center 8.82 4.37 13.26
DIF_stipe_shell Stage II stipe shell 9.81 4.93 14.69
DIF_stipe_skin Stage II stipe skin 12.75 6.63 18.87
DIF_cap_skin Stage II cap skin 9.63 4.82 14.43
DIF_cap_tissue Stage II cap tissue 8.86 4.40 13.33
DIF_gill_tissue Stage II gill tissue 8.64 4.23 13.05
YFB_stipe_center Young fruiting body stipe center 12.27 6.16 18.39
YFB_stipe_shell Young fruiting body stipe shell 12.87 6.60 19.14
YFB_stipe_skin Young fruiting body stipe skin 11.43 5.65 17.21
YFB_cap_skin Young fruiting body cap skin 8.17 4.00 12.35
YFB_cap_tissue Young fruiting body cap tissue 5.97 2.79 9.16
YFB_gill_tissue Young fruiting body gill tissue 9.50 4.77 14.24
YFB_veil Young fruiting body veil 8.69 4.25 13.13

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.022111 yes
Casing YFB_stipe_shell 0.041603 yes
Casing YFB_stipe_skin 0.015242 yes
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.002084 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.693586 no
Casing Pileal_Stipeal_center 0.001625 yes
Casing Pileal_Stipeal_shell 0.003765 yes
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.001625 yes
Casing DIF_stipe_skin 0.036683 yes
Casing DIF_cap_skin 0.001140 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.378882 no
DIF_gill_tissue YFB_stipe_shell 0.303559 no
DIF_gill_tissue YFB_stipe_skin 0.528583 no
DIF_gill_tissue YFB_cap_skin 0.933372 no
DIF_gill_tissue YFB_cap_tissue 0.366549 no
DIF_gill_tissue YFB_gill_tissue 0.878157 no
DIF_gill_tissue YFB_veil 0.992209 no
YFB_stipe_center YFB_stipe_shell 0.941956 no
YFB_stipe_center YFB_stipe_skin 0.910605 no
YFB_stipe_center YFB_cap_skin 0.283365 no
YFB_stipe_center YFB_cap_tissue 0.026461 yes
YFB_stipe_center YFB_gill_tissue 0.567159 no
YFB_stipe_center YFB_veil 0.384811 no
YFB_stipe_shell YFB_stipe_skin 0.837806 no
YFB_stipe_shell YFB_cap_skin 0.214129 no
YFB_stipe_shell YFB_cap_tissue 0.017783 yes
YFB_stipe_shell YFB_gill_tissue 0.480199 no
YFB_stipe_shell YFB_veil 0.310583 no
YFB_stipe_skin YFB_cap_skin 0.420996 no
YFB_stipe_skin YFB_cap_tissue 0.058732 no
YFB_stipe_skin YFB_gill_tissue 0.719140 no
YFB_stipe_skin YFB_veil 0.533691 no
YFB_cap_skin YFB_cap_tissue 0.468197 no
YFB_cap_skin YFB_gill_tissue 0.782614 no
YFB_cap_skin YFB_veil 0.921640 no
YFB_cap_tissue YFB_gill_tissue 0.214014 no
YFB_cap_tissue YFB_veil 0.348877 no
YFB_gill_tissue YFB_veil 0.881993 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.003365 yes
Initials YFB_stipe_shell 0.007092 yes
Initials YFB_stipe_skin 0.001625 yes
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.000613 yes
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.000613 yes
Initials Pileal_Stipeal_shell 0.000613 yes
Initials DIF_stipe_center 0.000613 yes
Initials DIF_stipe_shell 0.000613 yes
Initials DIF_stipe_skin 0.006387 yes
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.741436 no
Pileal_Stipeal_center YFB_stipe_center 0.709908 no
Pileal_Stipeal_center YFB_stipe_shell 0.616585 no
Pileal_Stipeal_center YFB_stipe_skin 0.842745 no
Pileal_Stipeal_center YFB_cap_skin 0.632448 no
Pileal_Stipeal_center YFB_cap_tissue 0.126752 no
Pileal_Stipeal_center YFB_gill_tissue 0.906582 no
Pileal_Stipeal_center YFB_veil 0.748179 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.918570 no
Pileal_Stipeal_center DIF_stipe_center 0.781318 no
Pileal_Stipeal_center DIF_stipe_shell 0.949363 no
Pileal_Stipeal_center DIF_stipe_skin 0.635121 no
Pileal_Stipeal_center DIF_cap_skin 0.923650 no
Pileal_Stipeal_center DIF_cap_tissue 0.790927 no
Pileal_Stipeal_shell DIF_gill_tissue 0.862221 no
Pileal_Stipeal_shell YFB_stipe_center 0.596542 no
Pileal_Stipeal_shell YFB_stipe_shell 0.502819 no
Pileal_Stipeal_shell YFB_stipe_skin 0.739769 no
Pileal_Stipeal_shell YFB_cap_skin 0.766104 no
Pileal_Stipeal_shell YFB_cap_tissue 0.211921 no
Pileal_Stipeal_shell YFB_gill_tissue 0.987595 no
Pileal_Stipeal_shell YFB_veil 0.867574 no
Pileal_Stipeal_shell DIF_stipe_center 0.893147 no
Pileal_Stipeal_shell DIF_stipe_shell 0.973480 no
Pileal_Stipeal_shell DIF_stipe_skin 0.520309 no
Pileal_Stipeal_shell DIF_cap_skin 0.996132 no
Pileal_Stipeal_shell DIF_cap_tissue 0.900654 no
DIF_stipe_center DIF_gill_tissue 0.977392 no
DIF_stipe_center YFB_stipe_center 0.422809 no
DIF_stipe_center YFB_stipe_shell 0.342562 no
DIF_stipe_center YFB_stipe_skin 0.570884 no
DIF_stipe_center YFB_cap_skin 0.907196 no
DIF_stipe_center YFB_cap_tissue 0.335605 no
DIF_stipe_center YFB_gill_tissue 0.909219 no
DIF_stipe_center YFB_veil 0.982660 no
DIF_stipe_center DIF_stipe_shell 0.860254 no
DIF_stipe_center DIF_stipe_skin 0.358057 no
DIF_stipe_center DIF_cap_skin 0.890007 no
DIF_stipe_center DIF_cap_tissue 0.992912 no
DIF_stipe_shell DIF_gill_tissue 0.826734 no
DIF_stipe_shell YFB_stipe_center 0.640735 no
DIF_stipe_shell YFB_stipe_shell 0.547396 no
DIF_stipe_shell YFB_stipe_skin 0.782077 no
DIF_stipe_shell YFB_cap_skin 0.727960 no
DIF_stipe_shell YFB_cap_tissue 0.188034 no
DIF_stipe_shell YFB_gill_tissue 0.962344 no
DIF_stipe_shell YFB_veil 0.831933 no
DIF_stipe_shell DIF_stipe_skin 0.564465 no
DIF_stipe_shell DIF_cap_skin 0.978058 no
DIF_stipe_shell DIF_cap_tissue 0.868329 no
DIF_stipe_skin DIF_gill_tissue 0.309178 no
DIF_stipe_skin YFB_stipe_center 0.955087 no
DIF_stipe_skin YFB_stipe_shell 0.989276 no
DIF_stipe_skin YFB_stipe_skin 0.851978 no
DIF_stipe_skin YFB_cap_skin 0.225264 no
DIF_stipe_skin YFB_cap_tissue 0.019442 yes
DIF_stipe_skin YFB_gill_tissue 0.491869 no
DIF_stipe_skin YFB_veil 0.320910 no
DIF_stipe_skin DIF_cap_skin 0.523497 no
DIF_stipe_skin DIF_cap_tissue 0.360361 no
DIF_cap_skin DIF_gill_tissue 0.861537 no
DIF_cap_skin YFB_stipe_center 0.603755 no
DIF_cap_skin YFB_stipe_shell 0.509225 no
DIF_cap_skin YFB_stipe_skin 0.749798 no
DIF_cap_skin YFB_cap_skin 0.764692 no
DIF_cap_skin YFB_cap_tissue 0.208106 no
DIF_cap_skin YFB_gill_tissue 0.984649 no
DIF_cap_skin YFB_veil 0.865842 no
DIF_cap_skin DIF_cap_tissue 0.898684 no
DIF_cap_tissue DIF_gill_tissue 0.971675 no
DIF_cap_tissue YFB_stipe_center 0.425607 no
DIF_cap_tissue YFB_stipe_shell 0.348314 no
DIF_cap_tissue YFB_stipe_skin 0.576675 no
DIF_cap_tissue YFB_cap_skin 0.898761 no
DIF_cap_tissue YFB_cap_tissue 0.326052 no
DIF_cap_tissue YFB_gill_tissue 0.915888 no
DIF_cap_tissue YFB_veil 0.976896 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|019760
MNLLRLPIEIIVDILLCLDVSDAYAVQALNHFFRNLYKTSLILQYALECKIAHVRDNPNCHLPIPERLQILRERE
SAWSSLTPTSKRITALPAGPGKCISNTRRLKIQPNHCTLFEYSKVSQLAFRKYFQISSIREIKEDSFHPIPLGIG
NLMHVGFCVDEHDLIACLTKNSLPDSQIELRLVLLQYSTGKAHPLAMEPNILVFRNDVSNNCYNFMANNIEIFGE
NLVLTIRLLKAGVEVECMYVYNWKTGQAKCEPIPVSNCDVVVLDQNLVIVPDPKEWSLYIFYIPSSSSGGPVKLI
QQLDLPPCHVGRSSFISCRSLPNPTEDGRFPKYISSSIPFMDKPDTALICITLLATASLLVHRDSIMRLLPPSEE
WSAVTKHLILDWDSWGPPVTAIQRRVTSTYGQRSLYVSEFGLRCCDFNKHHVRRSTEVKLPDLYEPFMINDVNLI
TTRLPCVEIVSPSKEFSGKYLADGAVVGMKKRKNTIEVSYFGGWMVKSYVLGFNAYSCDHYIPPVSRINGFR*
Coding >AgabiH97|019760
ATGAATCTCCTCCGACTCCCTATCGAAATCATTGTTGATATTTTGTTATGCCTAGATGTTTCTGATGCATACGCT
GTTCAAGCACTCAATCACTTTTTCCGCAACTTGTACAAAACATCTCTCATTCTTCAGTATGCTCTCGAGTGCAAA
ATTGCTCACGTTCGCGACAATCCGAATTGCCATCTACCTATTCCCGAACGGCTACAAATTCTGAGAGAGAGGGAA
TCAGCATGGAGCTCGCTAACGCCCACGTCCAAAAGGATAACAGCGCTTCCGGCTGGCCCGGGAAAATGCATATCA
AATACAAGGCGTCTTAAAATACAGCCAAACCATTGCACGTTATTCGAGTACTCCAAAGTCAGTCAGTTGGCATTC
CGGAAATATTTCCAAATCTCGTCGATCCGGGAAATCAAAGAAGATTCTTTCCATCCAATTCCGCTTGGGATTGGA
AATCTCATGCACGTCGGCTTTTGCGTCGATGAGCATGATCTCATTGCCTGCCTCACGAAGAACAGCCTGCCTGAC
TCTCAAATCGAGCTCAGACTCGTCCTGCTCCAGTACTCTACAGGAAAAGCTCATCCCCTTGCAATGGAGCCCAAC
ATTCTCGTGTTCCGCAATGACGTTTCGAACAACTGTTACAACTTTATGGCCAATAATATAGAAATATTCGGTGAA
AACCTCGTCCTCACGATTCGTTTGCTAAAAGCTGGCGTAGAGGTCGAGTGCATGTATGTTTATAATTGGAAAACG
GGCCAAGCCAAATGTGAACCTATACCAGTGTCGAACTGTGATGTCGTCGTTCTCGATCAGAATCTAGTGATCGTC
CCTGACCCCAAGGAATGGTCACTGTACATATTTTACATCCCCTCCTCGTCTTCTGGTGGACCTGTTAAGTTAATA
CAGCAACTTGATCTCCCCCCATGTCACGTCGGCCGAAGTAGTTTCATATCATGTCGAAGCCTACCAAATCCAACC
GAAGATGGTCGATTCCCTAAATATATATCATCTTCCATTCCCTTCATGGACAAGCCAGATACTGCTCTTATCTGC
ATCACCCTACTCGCTACAGCTTCATTACTCGTTCACAGGGACTCAATCATGAGACTCCTTCCCCCTTCAGAAGAG
TGGTCGGCCGTCACAAAGCATTTAATTCTTGATTGGGACTCTTGGGGGCCTCCTGTCACGGCAATTCAACGACGG
GTCACTAGTACATATGGACAGCGTTCCCTATATGTCTCGGAGTTCGGCCTTCGCTGTTGTGACTTTAACAAACAC
CACGTTCGCCGTTCCACTGAAGTCAAGCTGCCCGATCTCTATGAGCCTTTCATGATCAATGATGTGAATCTCATC
ACTACCAGATTACCATGCGTTGAAATTGTCTCGCCTAGTAAAGAATTTTCGGGTAAATATCTCGCAGATGGTGCG
GTTGTTGGAATGAAGAAGCGTAAAAATACCATCGAAGTATCCTATTTTGGTGGTTGGATGGTAAAGTCATATGTT
CTAGGCTTCAACGCATATTCGTGTGATCATTATATCCCTCCGGTTTCACGTATAAACGGGTTTCGGTAA
Transcript >AgabiH97|019760
ATGAATCTCCTCCGACTCCCTATCGAAATCATTGTTGATATTTTGTTATGCCTAGATGTTTCTGATGCATACGCT
GTTCAAGCACTCAATCACTTTTTCCGCAACTTGTACAAAACATCTCTCATTCTTCAGTATGCTCTCGAGTGCAAA
ATTGCTCACGTTCGCGACAATCCGAATTGCCATCTACCTATTCCCGAACGGCTACAAATTCTGAGAGAGAGGGAA
TCAGCATGGAGCTCGCTAACGCCCACGTCCAAAAGGATAACAGCGCTTCCGGCTGGCCCGGGAAAATGCATATCA
AATACAAGGCGTCTTAAAATACAGCCAAACCATTGCACGTTATTCGAGTACTCCAAAGTCAGTCAGTTGGCATTC
CGGAAATATTTCCAAATCTCGTCGATCCGGGAAATCAAAGAAGATTCTTTCCATCCAATTCCGCTTGGGATTGGA
AATCTCATGCACGTCGGCTTTTGCGTCGATGAGCATGATCTCATTGCCTGCCTCACGAAGAACAGCCTGCCTGAC
TCTCAAATCGAGCTCAGACTCGTCCTGCTCCAGTACTCTACAGGAAAAGCTCATCCCCTTGCAATGGAGCCCAAC
ATTCTCGTGTTCCGCAATGACGTTTCGAACAACTGTTACAACTTTATGGCCAATAATATAGAAATATTCGGTGAA
AACCTCGTCCTCACGATTCGTTTGCTAAAAGCTGGCGTAGAGGTCGAGTGCATGTATGTTTATAATTGGAAAACG
GGCCAAGCCAAATGTGAACCTATACCAGTGTCGAACTGTGATGTCGTCGTTCTCGATCAGAATCTAGTGATCGTC
CCTGACCCCAAGGAATGGTCACTGTACATATTTTACATCCCCTCCTCGTCTTCTGGTGGACCTGTTAAGTTAATA
CAGCAACTTGATCTCCCCCCATGTCACGTCGGCCGAAGTAGTTTCATATCATGTCGAAGCCTACCAAATCCAACC
GAAGATGGTCGATTCCCTAAATATATATCATCTTCCATTCCCTTCATGGACAAGCCAGATACTGCTCTTATCTGC
ATCACCCTACTCGCTACAGCTTCATTACTCGTTCACAGGGACTCAATCATGAGACTCCTTCCCCCTTCAGAAGAG
TGGTCGGCCGTCACAAAGCATTTAATTCTTGATTGGGACTCTTGGGGGCCTCCTGTCACGGCAATTCAACGACGG
GTCACTAGTACATATGGACAGCGTTCCCTATATGTCTCGGAGTTCGGCCTTCGCTGTTGTGACTTTAACAAACAC
CACGTTCGCCGTTCCACTGAAGTCAAGCTGCCCGATCTCTATGAGCCTTTCATGATCAATGATGTGAATCTCATC
ACTACCAGATTACCATGCGTTGAAATTGTCTCGCCTAGTAAAGAATTTTCGGGTAAATATCTCGCAGATGGTGCG
GTTGTTGGAATGAAGAAGCGTAAAAATACCATCGAAGTATCCTATTTTGGTGGTTGGATGGTAAAGTCATATGTT
CTAGGCTTCAACGCATATTCGTGTGATCATTATATCCCTCCGGTTTCACGTATAAACGGGTTTCGGTAA
Gene >AgabiH97|019760
ATGAATCTCCTCCGACTCCCTATCGAAATCATTGTTGATATTTTGTTATGCCTAGATGTTTCTGATGCATACGCT
GTTCAAGCACTCAATCACTTTTTCCGCAACTTGTACAAAACATCTCTCATTCTTCAGTATGCTCTCGAGTGCAAA
ATTGCTCACGTTCGCGACAATCCGAATTGCCATCTACCTATTCCCGAACGGCTACAAATTCTGAGAGAGAGGGAA
TCAGCATGGAGCTCGCTAACGCCCACGTCCAAAAGGATAACAGCGCTTCCGGCTGGCCCGGGAAAATGCATATCA
AATACAAGGCGTCTTAAAATACAGCCAAACCATTGCACGTTATTCGAGTACTCCAAAGTCAGTCAGTTGGCATTC
CGGAAATATTTCCAAATCTCGTCGATCCGGGAAATCAAAGAAGATTCTTTCCATCCAATTCCGCTTGGGATTGGA
AATCTCATGCACGTCGGCTTTTGCGTCGATGAGCATGATCTCATTGCCTGCCTCACGAAGTGAGTAATACAGCAC
TTATCATGAGGTGGCTATTCTGAAAGTCACCGGCCATAGGAACAGCCTGCCTGACTCTCAAATCGAGCTCAGACT
CGTCCTGCTCCAGTACTCTACAGGAAAAGCTCATCCCCTTGCAATGGAGCCCAACATTCTCGTGTTCCGCAATGA
CGTTTCGAACAACTGTTACAACTTTATGGCCAATAATATAGAAATATTCGGTGAAAACCTCGTCCTCACGATTCG
TTTGCTAAAAGCTGGCGTAGAGGTCGAGTGCATGTATGTTTATAATTGGAAAACGGGCCAAGCCAAATGTGTGCG
TTGTCCTTAGGATACTCATGACCAGTTGACCCAAATCTCTTCACAAAGGAACCTATACCAGTGTCGAACTGTGAT
GTCGTCGTTCTCGATCAGAATCTAGTGATCGTCCCTGACCCCAAGGAATGGTCACTGTACATATTTTACATCCCC
TCCTCGTCTTCTGGTGGACCTGTTAAGTTAATACAGCAACTTGATCTCCCCCCATGTCACGTCGGCCGAAGTAGT
TTCATATCATGTCGAAGCCTACCAAATCCAACCGAAGATGGTCGATTCCCTAAATATATATCATCTTCCATTCCC
TTCATGGACAAGCCAGATACTGCTCTTATCTGCATCACCCTACTCGCTACAGCTTCATTACTCGTTCACAGGGAC
TCAATCATGAGACTCCTTCCCCCTTCAGAAGAGTGGTCGGCCGTCACAAAGCATTTAATTCTTGATTGGGACTCT
TGGGGGCCTCCTGTCACGGCAATTCAACGACGGGTCACTAGTACATATGGACAGCGTTCCCTATATGTCTCGGAG
TTCGGCCTTCGCTGTTGTGACTTTAACAAACACCACGTTCGCCGTTCCACTGAAGTCAAGCTGCCCGATCTCTAT
GAGCCTTTCATGATCAATGATGTGAATCTCATCACTACCAGATTACCATGCGTTGAAATTGTCTCGCCTAGTAAA
GAATTTTCGGGTAAATATCTCGCAGATGGTGCGGTTGTTGGAATGAAGGTTAGGCCATTCTTGACTGATTGAGAC
GCTGCTGACGTTTTGAAGAAGCGTAAAAATACCATCGAAGTATCCTATTTTGGTCAATAAAAATGCTGCTGGATT
TACCATCGCGCAGTCGTTGTCATGCAGGTGAAGTCTGATGGATCATGACGCACCGACTAGGTGGTTGGATGGTAA
AGTAAGCTGACCCGTTGCATCAGATCTTTTCCATAATCTGACGTTGTGTTCACCTAGGTCATATGTTCTAGGCTT
CAACGCATATTCGTGTGATCATTATATCCCTCCGGTTTCACGTATAAACGGGTTTCGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail