Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|019740
Gene name
Locationscaffold_10:1264953..1266017
Strand+
Gene length (bp)1064
Transcript length (bp)828
Coding sequence length (bp)828
Protein length (aa) 276

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Golgi apparatus Signal peptide|Transmembrane domain 0.1198 0.1053 0.1577 0.3517 0.2086 0.0022 0.0583 0.2269 0.375 0.0075

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 4 23 19
2 44 66 22
3 76 98 22
4 118 140 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup1245
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|019720
Agaricus bisporus var bisporus H39 AgabiH39|019730
Agaricus bisporus var bisporus H39 AgabiH39|019740
Agaricus bisporus var bisporus H39 AgabiH39|019750
Agaricus bisporus var bisporus H39 AgabiH39|019950
Agaricus bisporus var bisporus H39 AgabiH39|020020
Agaricus bisporus var bisporus H39 AgabiH39|479900
Agaricus bisporus var bisporus H39 AgabiH39|539400
Agaricus bisporus var bisporus H97 AgabiH97|019720
Agaricus bisporus var bisporus H97 AgabiH97|019730
Agaricus bisporus var bisporus H97 AgabiH97|019740 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|019750
Agaricus bisporus var bisporus H97 AgabiH97|019950
Agaricus bisporus var bisporus H97 AgabiH97|020020
Agaricus bisporus var bisporus H97 AgabiH97|020210
Agaricus bisporus var bisporus H97 AgabiH97|034710

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|019740
MMTVVILLFISSTTILGLQLAIVMRNYMYLLQARADDFQTERRAFILSQAVLLIFQTIIADSVLLFRCWTIWNKM
ILAIVIPLVLWAGCLGSSVYAIYCLYFRIFSGPNPISAEESIYPAYVTFWTCTIIVNIYCTGMIVGRICSVQQGW
RPPSICSLRDLPQRTRLQLAKRIVVESAMIYTAASLSAFITHACESPAVDITYLAESQIVGIAFNLILIRRSPSP
KHDRGSEFCVRCLNPKTNRSIADATVGTTDSVDIRDASLSASEGITDWKE*
Coding >AgabiH97|019740
ATGATGACGGTCGTTATCCTACTCTTCATCTCTTCTACAACAATCTTGGGACTCCAGCTCGCTATTGTTATGCGG
AACTACATGTACTTGTTGCAGGCTCGTGCAGACGACTTTCAGACGGAACGAAGAGCGTTCATTCTTTCACAAGCG
GTCCTGTTGATTTTTCAGACCATTATTGCAGATAGCGTCTTGCTCTTCAGGTGTTGGACTATCTGGAATAAGATG
ATTCTCGCTATAGTTATACCCCTGGTTCTTTGGGCAGGCTGTCTGGGTTCTAGCGTCTACGCTATTTACTGCTTA
TATTTCCGGATCTTCTCGGGCCCGAACCCAATATCTGCTGAGGAAAGTATTTATCCTGCCTACGTGACGTTCTGG
ACTTGCACAATCATAGTGAACATTTACTGCACGGGAATGATTGTAGGGAGAATTTGTTCCGTGCAACAAGGTTGG
AGACCGCCCTCAATATGCTCTTTACGGGATCTACCACAACGAACCCGCTTGCAACTTGCCAAACGTATAGTCGTC
GAGTCGGCTATGATATATACCGCGGCATCTTTGAGTGCCTTTATCACTCATGCTTGTGAGAGTCCCGCAGTTGAC
ATCACATATCTAGCCGAATCTCAAATTGTCGGAATTGCGTTCAATTTGATACTTATCAGGCGTTCGCCGTCTCCG
AAGCATGACCGAGGAAGCGAGTTTTGCGTCAGGTGCTTGAATCCGAAGACAAACCGCTCGATAGCGGACGCTACG
GTCGGAACCACAGACTCAGTTGATATACGAGATGCGTCGTTGAGCGCTAGTGAGGGGATAACAGATTGGAAAGAA
TGA
Transcript >AgabiH97|019740
ATGATGACGGTCGTTATCCTACTCTTCATCTCTTCTACAACAATCTTGGGACTCCAGCTCGCTATTGTTATGCGG
AACTACATGTACTTGTTGCAGGCTCGTGCAGACGACTTTCAGACGGAACGAAGAGCGTTCATTCTTTCACAAGCG
GTCCTGTTGATTTTTCAGACCATTATTGCAGATAGCGTCTTGCTCTTCAGGTGTTGGACTATCTGGAATAAGATG
ATTCTCGCTATAGTTATACCCCTGGTTCTTTGGGCAGGCTGTCTGGGTTCTAGCGTCTACGCTATTTACTGCTTA
TATTTCCGGATCTTCTCGGGCCCGAACCCAATATCTGCTGAGGAAAGTATTTATCCTGCCTACGTGACGTTCTGG
ACTTGCACAATCATAGTGAACATTTACTGCACGGGAATGATTGTAGGGAGAATTTGTTCCGTGCAACAAGGTTGG
AGACCGCCCTCAATATGCTCTTTACGGGATCTACCACAACGAACCCGCTTGCAACTTGCCAAACGTATAGTCGTC
GAGTCGGCTATGATATATACCGCGGCATCTTTGAGTGCCTTTATCACTCATGCTTGTGAGAGTCCCGCAGTTGAC
ATCACATATCTAGCCGAATCTCAAATTGTCGGAATTGCGTTCAATTTGATACTTATCAGGCGTTCGCCGTCTCCG
AAGCATGACCGAGGAAGCGAGTTTTGCGTCAGGTGCTTGAATCCGAAGACAAACCGCTCGATAGCGGACGCTACG
GTCGGAACCACAGACTCAGTTGATATACGAGATGCGTCGTTGAGCGCTAGTGAGGGGATAACAGATTGGAAAGAA
TGA
Gene >AgabiH97|019740
ATGATGACGGTCGTTATCCTACTCTTCATCTCTTCTACAACAATCTTGGGACTCCAGCTCGCTATTGTTATGCGG
AACTACATGTACTTGTTGCAGGCTCGTGCAGACGACTTTCAGACGGAACGAAGAGCGTTCATTCTTTCACAAGTA
AGTTTCCTTTTTCTTTGGCCCGATTGCGAGTGTCGCGATCAATGCGTTAACGTTAATATCCGGCCGTGTTAGGCG
GTCCTGTTGATTTTTCAGACCATTATTGCAGATAGCGTCTTGGTAAGATTTTGAAGGGTATCCCTGGGGGAAAAA
CTGACAATTTGGACCATAACTTCAGCTCTTCAGGTGTTGGACTATCTGGAATAAGATGATTCTCGCTATAGTTAT
ACCCCTGGTTCTTTGGGCAGGCTGTCTGGGTTCTAGCGTCTACGCTATTTACTGCTTATATTTCCGGATCTTCTC
GGGCCCGAACCCAATATCTGCTGAGGAAAGTATTTATCCTGCCTACGTGACGTTCTGGACTTGCACAATCATAGT
GAACATTTACTGCACGGGTAAGCCACCTAGCCTGGAAAACTTAACTTTGTCATCGATTTACAATCTTGTAGGAAT
GATTGTAGGGAGAATTTGTTCCGTGCAACAAGGTTGGAGACCGCCCTCAATATGCTCTTTACGGGATCTACCACA
ACGAACCCGCTTGCAACTTGCCAAACGTATAGTCGTCGAGTCGGCTATGATATATACCGCGGCATCTTTGAGTGC
CTTTATCACTCATGCTTGTGAGAGTCCCGCAGTTGACATCACATATCTAGCCGTAGGTCATCCGATTGTAAGACC
GATCACGTTCTTATTATGTTGAACAGGAATCTCAAATTGTCGGAATTGCGTTCAATTTGATACTTATCAGGCGTT
CGCCGTCTCCGAAGCATGACCGAGGAAGCGAGTTTTGCGTCAGGTGCTTGAATCCGAAGACAAACCGCTCGATAG
CGGACGCTACGGTCGGAACCACAGACTCAGTTGATATACGAGATGCGTCGTTGAGCGCTAGTGAGGGGATAACAG
ATTGGAAAGAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail