Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|019730
Gene name
Locationscaffold_10:1262702..1263873
Strand+
Gene length (bp)1171
Transcript length (bp)888
Coding sequence length (bp)888
Protein length (aa) 296

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 44 66 22
3 79 101 22
4 121 143 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 58.86 33.17 84.54
Initials Initials knots 51.25 28.89 73.62
Pileal_Stipeal_center Stage I stipe center 26.77 13.64 39.90
Pileal_Stipeal_shell Stage I stipe shell 20.40 10.14 30.66
DIF_stipe_center Stage II stipe center 14.95 7.22 22.67
DIF_stipe_shell Stage II stipe shell 23.48 12.03 34.93
DIF_stipe_skin Stage II stipe skin 32.20 17.28 47.13
DIF_cap_skin Stage II cap skin 25.63 13.17 38.08
DIF_cap_tissue Stage II cap tissue 19.07 9.35 28.80
DIF_gill_tissue Stage II gill tissue 12.94 6.05 19.82
YFB_stipe_center Young fruiting body stipe center 19.79 9.91 29.67
YFB_stipe_shell Young fruiting body stipe shell 19.23 9.64 28.82
YFB_stipe_skin Young fruiting body stipe skin 30.57 16.28 44.85
YFB_cap_skin Young fruiting body cap skin 27.04 14.18 39.90
YFB_cap_tissue Young fruiting body cap tissue 12.36 5.81 18.91
YFB_gill_tissue Young fruiting body gill tissue 21.29 10.56 32.03
YFB_veil Young fruiting body veil 14.03 6.72 21.33

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.000613 yes
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.031800 yes
Casing YFB_cap_skin 0.008791 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.775080 no
Casing Pileal_Stipeal_center 0.007782 yes
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.002525 yes
Casing DIF_stipe_skin 0.043983 yes
Casing DIF_cap_skin 0.006032 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.277790 no
DIF_gill_tissue YFB_stipe_shell 0.328438 no
DIF_gill_tissue YFB_stipe_skin 0.005671 yes
DIF_gill_tissue YFB_cap_skin 0.021846 yes
DIF_gill_tissue YFB_cap_tissue 0.948499 no
DIF_gill_tissue YFB_gill_tissue 0.190859 no
DIF_gill_tissue YFB_veil 0.903717 no
YFB_stipe_center YFB_stipe_shell 0.965311 no
YFB_stipe_center YFB_stipe_skin 0.241478 no
YFB_stipe_center YFB_cap_skin 0.445853 no
YFB_stipe_center YFB_cap_tissue 0.215044 no
YFB_stipe_center YFB_gill_tissue 0.910530 no
YFB_stipe_center YFB_veil 0.414707 no
YFB_stipe_shell YFB_stipe_skin 0.208451 no
YFB_stipe_shell YFB_cap_skin 0.394578 no
YFB_stipe_shell YFB_cap_tissue 0.261654 no
YFB_stipe_shell YFB_gill_tissue 0.869625 no
YFB_stipe_shell YFB_veil 0.475766 no
YFB_stipe_skin YFB_cap_skin 0.819833 no
YFB_stipe_skin YFB_cap_tissue 0.004160 yes
YFB_stipe_skin YFB_gill_tissue 0.356963 no
YFB_stipe_skin YFB_veil 0.017507 yes
YFB_cap_skin YFB_cap_tissue 0.017226 yes
YFB_cap_skin YFB_gill_tissue 0.597205 no
YFB_cap_skin YFB_veil 0.050706 no
YFB_cap_tissue YFB_gill_tissue 0.140560 no
YFB_cap_tissue YFB_veil 0.831359 no
YFB_gill_tissue YFB_veil 0.299255 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.002084 yes
Initials YFB_stipe_shell 0.001140 yes
Initials YFB_stipe_skin 0.102511 no
Initials YFB_cap_skin 0.034142 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.003765 yes
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.032742 yes
Initials Pileal_Stipeal_shell 0.002084 yes
Initials DIF_stipe_center 0.000613 yes
Initials DIF_stipe_shell 0.008457 yes
Initials DIF_stipe_skin 0.143621 no
Initials DIF_cap_skin 0.021583 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.027943 yes
Pileal_Stipeal_center YFB_stipe_center 0.475023 no
Pileal_Stipeal_center YFB_stipe_shell 0.421621 no
Pileal_Stipeal_center YFB_stipe_skin 0.807825 no
Pileal_Stipeal_center YFB_cap_skin 0.987837 no
Pileal_Stipeal_center YFB_cap_tissue 0.022369 yes
Pileal_Stipeal_center YFB_gill_tissue 0.627312 no
Pileal_Stipeal_center YFB_veil 0.059318 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.543825 no
Pileal_Stipeal_center DIF_stipe_center 0.096785 no
Pileal_Stipeal_center DIF_stipe_shell 0.814305 no
Pileal_Stipeal_center DIF_stipe_skin 0.697866 no
Pileal_Stipeal_center DIF_cap_skin 0.947723 no
Pileal_Stipeal_center DIF_cap_tissue 0.406596 no
Pileal_Stipeal_shell DIF_gill_tissue 0.234848 no
Pileal_Stipeal_shell YFB_stipe_center 0.965257 no
Pileal_Stipeal_shell YFB_stipe_shell 0.928403 no
Pileal_Stipeal_shell YFB_stipe_skin 0.290760 no
Pileal_Stipeal_shell YFB_cap_skin 0.511183 no
Pileal_Stipeal_shell YFB_cap_tissue 0.179826 no
Pileal_Stipeal_shell YFB_gill_tissue 0.950558 no
Pileal_Stipeal_shell YFB_veil 0.365159 no
Pileal_Stipeal_shell DIF_stipe_center 0.488553 no
Pileal_Stipeal_shell DIF_stipe_shell 0.802589 no
Pileal_Stipeal_shell DIF_stipe_skin 0.201152 no
Pileal_Stipeal_shell DIF_cap_skin 0.637550 no
Pileal_Stipeal_shell DIF_cap_tissue 0.919545 no
DIF_stipe_center DIF_gill_tissue 0.811015 no
DIF_stipe_center YFB_stipe_center 0.540289 no
DIF_stipe_center YFB_stipe_shell 0.598702 no
DIF_stipe_center YFB_stipe_skin 0.031088 yes
DIF_stipe_center YFB_cap_skin 0.085726 no
DIF_stipe_center YFB_cap_tissue 0.725366 no
DIF_stipe_center YFB_gill_tissue 0.406363 no
DIF_stipe_center YFB_veil 0.928160 no
DIF_stipe_center DIF_stipe_shell 0.235485 no
DIF_stipe_center DIF_stipe_skin 0.018896 yes
DIF_stipe_center DIF_cap_skin 0.138008 no
DIF_stipe_center DIF_cap_tissue 0.612598 no
DIF_stipe_shell DIF_gill_tissue 0.083328 no
DIF_stipe_shell YFB_stipe_center 0.742098 no
DIF_stipe_shell YFB_stipe_shell 0.682919 no
DIF_stipe_shell YFB_stipe_skin 0.537931 no
DIF_stipe_shell YFB_cap_skin 0.788051 no
DIF_stipe_shell YFB_cap_tissue 0.059906 no
DIF_stipe_shell YFB_gill_tissue 0.872410 no
DIF_stipe_shell YFB_veil 0.156253 no
DIF_stipe_shell DIF_stipe_skin 0.420283 no
DIF_stipe_shell DIF_cap_skin 0.884928 no
DIF_stipe_shell DIF_cap_tissue 0.667435 no
DIF_stipe_skin DIF_gill_tissue 0.004548 yes
DIF_stipe_skin YFB_stipe_center 0.152056 no
DIF_stipe_skin YFB_stipe_shell 0.126175 no
DIF_stipe_skin YFB_stipe_skin 0.931244 no
DIF_stipe_skin YFB_cap_skin 0.707900 no
DIF_stipe_skin YFB_cap_tissue 0.001625 yes
DIF_stipe_skin YFB_gill_tissue 0.258723 no
DIF_stipe_skin YFB_veil 0.011659 yes
DIF_stipe_skin DIF_cap_skin 0.608145 no
DIF_stipe_skin DIF_cap_tissue 0.119615 no
DIF_cap_skin DIF_gill_tissue 0.041386 yes
DIF_cap_skin YFB_stipe_center 0.569256 no
DIF_cap_skin YFB_stipe_shell 0.512411 no
DIF_cap_skin YFB_stipe_skin 0.724644 no
DIF_cap_skin YFB_cap_skin 0.931882 no
DIF_cap_skin YFB_cap_tissue 0.029890 yes
DIF_cap_skin YFB_gill_tissue 0.717176 no
DIF_cap_skin YFB_veil 0.082983 no
DIF_cap_skin DIF_cap_tissue 0.498235 no
DIF_cap_tissue DIF_gill_tissue 0.333527 no
DIF_cap_tissue YFB_stipe_center 0.956934 no
DIF_cap_tissue YFB_stipe_shell 0.990418 no
DIF_cap_tissue YFB_stipe_skin 0.187677 no
DIF_cap_tissue YFB_cap_skin 0.368886 no
DIF_cap_tissue YFB_cap_tissue 0.260285 no
DIF_cap_tissue YFB_gill_tissue 0.853643 no
DIF_cap_tissue YFB_veil 0.481359 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|019730
MTMVVILLFICSTTVLGLQLALVMRSYMYLLQSREDDFETERRAFILSQGVLLIFQTIIADGVLLFRCWTIWNKM
ILAIVLPLVLWAGCLGSSVYAIYCLYFRIFTGPKPISTEESVYPAFVTFWTCTIIVNIYCTGMIVGRICSVQQGW
RPPSICSLRDLPQRTRLHLAKRIVVESAMIYTAASLGAFISHASESRAVDITYLAESQVVGIAFNLILIRRSSPT
QDRESELCVRCFNPKTNRSIADATVGTTDSLDIPDVSLSASEEDNRLERMNIIYRARPHTSSTNSLEEIH*
Coding >AgabiH97|019730
ATGACGATGGTCGTTATCCTCCTTTTCATCTGTTCCACAACTGTCTTGGGACTCCAGCTTGCCCTTGTTATGCGG
AGTTATATGTACTTGTTGCAGTCTCGTGAAGACGACTTTGAGACGGAACGAAGAGCGTTCATTCTCTCACAAGGG
GTCCTGCTGATTTTTCAGACAATCATTGCAGACGGCGTCTTGCTCTTCAGGTGTTGGACTATCTGGAATAAGATG
ATTCTTGCTATAGTTCTACCCCTGGTTCTTTGGGCAGGCTGTCTGGGTTCTAGCGTCTACGCTATTTACTGCTTA
TATTTTCGGATCTTCACGGGCCCGAAACCAATATCTACTGAGGAAAGTGTTTATCCAGCCTTCGTGACATTCTGG
ACTTGCACAATCATCGTGAACATTTACTGCACAGGAATGATTGTGGGGAGAATTTGTTCCGTGCAACAGGGTTGG
AGACCGCCCTCCATATGTTCTTTACGGGATCTACCACAACGAACCCGACTGCATCTTGCCAAACGTATAGTCGTC
GAGTCGGCTATGATATATACCGCGGCATCATTGGGCGCCTTTATCAGTCATGCTTCTGAGAGCCGCGCAGTTGAC
ATCACATATCTAGCCGAATCTCAAGTTGTCGGGATTGCTTTCAATTTGATACTTATCAGACGTTCGTCTCCGACG
CAGGACCGGGAAAGCGAATTATGCGTCAGATGTTTTAATCCGAAGACGAATCGCTCGATAGCTGACGCTACGGTC
GGAACCACAGACTCGCTTGATATACCAGATGTGTCATTGAGCGCTAGTGAGGAAGATAACAGATTGGAAAGAATG
AATATCATATACCGTGCCAGACCTCATACTAGTTCCACCAACTCGCTCGAAGAAATTCATTGA
Transcript >AgabiH97|019730
ATGACGATGGTCGTTATCCTCCTTTTCATCTGTTCCACAACTGTCTTGGGACTCCAGCTTGCCCTTGTTATGCGG
AGTTATATGTACTTGTTGCAGTCTCGTGAAGACGACTTTGAGACGGAACGAAGAGCGTTCATTCTCTCACAAGGG
GTCCTGCTGATTTTTCAGACAATCATTGCAGACGGCGTCTTGCTCTTCAGGTGTTGGACTATCTGGAATAAGATG
ATTCTTGCTATAGTTCTACCCCTGGTTCTTTGGGCAGGCTGTCTGGGTTCTAGCGTCTACGCTATTTACTGCTTA
TATTTTCGGATCTTCACGGGCCCGAAACCAATATCTACTGAGGAAAGTGTTTATCCAGCCTTCGTGACATTCTGG
ACTTGCACAATCATCGTGAACATTTACTGCACAGGAATGATTGTGGGGAGAATTTGTTCCGTGCAACAGGGTTGG
AGACCGCCCTCCATATGTTCTTTACGGGATCTACCACAACGAACCCGACTGCATCTTGCCAAACGTATAGTCGTC
GAGTCGGCTATGATATATACCGCGGCATCATTGGGCGCCTTTATCAGTCATGCTTCTGAGAGCCGCGCAGTTGAC
ATCACATATCTAGCCGAATCTCAAGTTGTCGGGATTGCTTTCAATTTGATACTTATCAGACGTTCGTCTCCGACG
CAGGACCGGGAAAGCGAATTATGCGTCAGATGTTTTAATCCGAAGACGAATCGCTCGATAGCTGACGCTACGGTC
GGAACCACAGACTCGCTTGATATACCAGATGTGTCATTGAGCGCTAGTGAGGAAGATAACAGATTGGAAAGAATG
AATATCATATACCGTGCCAGACCTCATACTAGTTCCACCAACTCGCTCGAAGAAATTCATTGA
Gene >AgabiH97|019730
ATGACGATGGTCGTTATCCTCCTTTTCATCTGTTCCACAACTGTCTTGGGACTCCAGCTTGCCCTTGTTATGCGG
AGTTATATGTACTTGTTGCAGTCTCGTGAAGACGACTTTGAGACGGAACGAAGAGCGTTCATTCTCTCACAAGTA
AGCTTTCCCCTTTTTCTTTGGCCCGATTGCGAGCCTGAGTTGTCGCGGACAATGCGTTAACGTCCAGCCATATTA
GGGGGTCCTGCTGATTTTTCAGACAATCATTGCAGACGGCGTCTTGGTAAGACTTTGAATTGATACCTGGGGGAA
AAACTGACAATTGGGAACTTCAGCTCTTCAGGTGTTGGACTATCTGGAATAAGATGATTCTTGCTATAGTTCTAC
CCCTGGTTCTTTGGGCAGGCTGTCTGGGTTCTAGCGTCTACGCTATTTACTGCTTATATTTTCGGATCTTCACGG
GCCCGAAACCAATATCTACTGAGGAAAGTGTTTATCCAGCCTTCGTGACATTCTGGACTTGCACAATCATCGTGA
ACATTTACTGCACAGGTAAGCCACCTAACCTGGAAAAACGTAACTTTATCATCGACTTACAATTTTGTAGGAATG
ATTGTGGGGAGAATTTGTTCCGTGCAACAGGGTTGGAGACCGCCCTCCATATGTTCTTTACGGGATCTACCACAA
CGAACCCGACTGCATCTTGCCAAACGTATAGTCGTCGAGTCGGCTATGATATATACCGCGGCATCATTGGGCGCC
TTTATCAGTCATGCTTCTGAGAGCCGCGCAGTTGACATCACATATCTAGCCGTAGGTCACCCGGTTGTAGGACCG
ATCACTCTCTTATCATGTTGAACAGGAATCTCAAGTTGTCGGGATTGCTTTCAATTTGATACTTATCAGACGTTC
GTCTCCGACGCAGGACCGGGAAAGCGAATTATGCGTCAGATGTTTTAATCCGAAGACGAATCGCTCGATAGCTGA
CGCTACGGTCGGAACCACAGACTCGCTTGATATACCAGATGTGTCATTGAGCGCTAGTGAGGAAGATAACAGATT
GGAAAGAATGAATATCATATACCGTGCCAGACCTCATACTAGGTGTATTGTATCACTTAATCAGAATTGTTCATA
GTCCGGTTATTGTAGTTCCACCAACTCGCTCGAAGAAATTCATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail