Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|019690
Gene name
Locationscaffold_10:1252761..1255179
Strand-
Gene length (bp)2418
Transcript length (bp)1572
Coding sequence length (bp)1572
Protein length (aa) 524

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.2E-33 84 435

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 25 506 9.0E-76
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 49 506 4.0E-73
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 32 511 7.0E-72
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 18 508 2.0E-69
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 59 510 4.0E-69
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 25 506 9.0E-76
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 49 506 4.0E-73
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 32 511 7.0E-72
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 18 508 2.0E-69
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 59 510 4.0E-69
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 11 508 9.0E-69
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 4 508 3.0E-68
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 11 510 4.0E-67
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 18 508 2.0E-66
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 24 517 5.0E-65
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 21 508 1.0E-64
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 17 506 2.0E-62
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 18 504 9.0E-62
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 41 504 2.0E-61
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 60 511 4.0E-61
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 25 510 4.0E-60
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 49 511 1.0E-58
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 18 508 2.0E-58
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 60 509 3.0E-54
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 60 509 4.0E-54
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 16 508 1.0E-53
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 25 498 5.0E-53
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 55 508 1.0E-49
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 55 508 3.0E-49
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 16 511 2.0E-45
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 9 508 6.0E-45
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 61 509 1.0E-44
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 16 520 3.0E-35
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 56 283 2.0E-26
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 11 496 1.0E-15
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 9 259 3.0E-12
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 8 283 1.0E-11
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 334 509 3.0E-11
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 38 402 1.0E-10
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 47 290 2.0E-10
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 16 260 5.0E-10
sp|G2TRN8|YI74_SCHPO Putative uncharacterized transporter C977.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.04 PE=5 SV=1 364 508 2.0E-09
sp|Q5A6P6|QDR1_CANAL MFS antiporter QDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR PE=2 SV=1 25 402 3.0E-09
sp|P44927|EMRB_HAEIN Multidrug export protein EmrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=emrB PE=3 SV=1 88 266 5.0E-09
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 56 255 1.0E-08
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 105 254 4.0E-08
sp|P40474|QDR2_YEAST Quinidine resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR2 PE=1 SV=1 40 259 6.0E-08
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 58 237 2.0E-07
sp|Q9D2V8|MFS10_MOUSE Major facilitator superfamily domain-containing protein 10 OS=Mus musculus GN=Mfsd10 PE=1 SV=1 95 255 4.0E-07
sp|Q14728|MFS10_HUMAN Major facilitator superfamily domain-containing protein 10 OS=Homo sapiens GN=MFSD10 PE=1 SV=1 95 255 8.0E-07
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 58 257 9.0E-07
sp|P28246|BCR_ECOLI Bicyclomycin resistance protein OS=Escherichia coli (strain K12) GN=bcr PE=1 SV=4 72 255 2.0E-06
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 104 256 2.0E-06
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 104 256 2.0E-06
sp|P46105|ACT22_STRCO Probable actinorhodin transporter OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actII-2 PE=3 SV=1 34 259 3.0E-06
sp|Q0P5M9|MFS10_BOVIN Major facilitator superfamily domain-containing protein 10 OS=Bos taurus GN=MFSD10 PE=2 SV=1 95 255 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

Domain # Start End Length
1 75 97 22
2 112 134 22
3 141 158 17
4 171 193 22
5 200 222 22
6 232 252 20
7 307 329 22
8 344 361 17
9 382 404 22
10 409 431 22
11 451 469 18
12 479 501 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|019690
MKFGQSYFSYFHAHPEPSKDTHTPDLEKDSTSKLTPLEPKENSLDTIAPEETIYVEYEPNDSRNPINFPRAKKWT
ITFVASASTLFTSATAASYALGFPSMTRDLSATQFQATVGLSMYTLGFGVVPLVTASFSEEFGRRPLYLVSGLGF
AIFYVMIAEAKNIQTVMVARLIQGSFGSTAATMVGGTIADIWAPAERGLPMAIFSLSALCGNGYGPLIAGWIEMN
SRLGWRWIQWIQLIIFAVTLLLVFIFLEETRSTVLLMRIAKKLREETGRSYKARIEDESVSLKHLIWISCTRPIR
LLLTEHVVLSFSLWIGFAWGVTYCMIQSIGMVFRTLHDFNDGQVGLVFISMLVGSFIGFFSNFYQEYLYKMYYPT
RGPEARLYCACVAAFFLPIAMFIYAWCSFSHVHWIGLVVGITLFVAAMFVVYLAVFSYLADCYGPYASSALAGQS
LARNIMATVFPLFTTQMYTNLTFKWANTLFGFLALAMIPIPFVLFFYGPSIRQRSKFSRRVLEAQQKASLEKM*
Coding >AgabiH97|019690
ATGAAGTTCGGTCAAAGCTATTTCTCTTATTTTCATGCTCATCCGGAGCCATCAAAGGATACCCATACCCCAGAC
CTAGAGAAGGATTCAACTTCAAAACTCACTCCTCTTGAACCGAAGGAAAATTCTCTGGATACGATAGCTCCTGAA
GAAACCATTTATGTTGAATATGAACCGAACGACTCAAGAAACCCTATCAATTTTCCTCGCGCGAAGAAATGGACG
ATAACTTTTGTCGCATCTGCTTCCACTTTGTTCACTTCCGCTACAGCGGCATCATACGCCTTAGGTTTCCCTTCA
ATGACACGCGATCTCTCTGCTACCCAGTTTCAAGCAACAGTCGGGCTCAGCATGTACACTCTAGGGTTTGGTGTA
GTGCCATTGGTCACTGCATCGTTCTCTGAGGAGTTTGGTCGACGGCCACTATATCTCGTCTCCGGACTCGGATTC
GCAATTTTCTATGTCATGATTGCTGAAGCAAAAAACATTCAAACCGTCATGGTGGCAAGACTCATACAAGGTTCA
TTTGGCTCTACAGCGGCGACGATGGTTGGTGGTACAATTGCAGACATTTGGGCACCTGCCGAGCGTGGTCTACCT
ATGGCTATCTTTTCGCTAAGTGCTCTATGCGGGAACGGTTATGGTCCTCTAATAGCGGGTTGGATCGAAATGAAT
TCACGACTTGGTTGGCGTTGGATACAATGGATTCAGCTCATCATTTTCGCTGTTACTCTCTTATTAGTCTTTATA
TTCCTTGAAGAGACCCGTTCTACTGTGCTCTTGATGCGTATAGCGAAGAAATTGAGAGAAGAGACAGGTCGAAGT
TACAAGGCGAGAATAGAAGATGAGAGTGTGAGTTTGAAACATCTCATTTGGATTTCTTGTACACGACCCATTCGT
CTATTACTTACGGAACATGTCGTCCTAAGTTTTAGCTTATGGATTGGTTTCGCTTGGGGTGTGACATATTGCATG
ATTCAATCTATTGGAATGGTTTTTCGGACTTTGCACGACTTTAATGACGGACAGGTTGGCCTAGTATTCATAAGT
ATGCTTGTGGGCTCTTTCATTGGATTTTTCTCGAATTTCTACCAAGAATACTTATACAAAATGTATTATCCAACG
AGAGGCCCAGAAGCACGTCTCTATTGTGCTTGTGTAGCAGCATTTTTCTTGCCGATAGCGATGTTCATATATGCC
TGGTGTTCATTCTCACATGTTCATTGGATAGGTTTGGTCGTTGGTATCACATTATTCGTGGCTGCTATGTTTGTT
GTGTACCTTGCAGTTTTCTCATATCTCGCCGATTGTTATGGTCCCTATGCATCATCCGCTCTTGCAGGTCAAAGT
CTTGCTCGTAACATAATGGCAACAGTTTTTCCTCTATTCACAACTCAAATGTATACCAACCTAACATTCAAATGG
GCAAATACCTTGTTCGGATTTTTAGCTTTGGCTATGATACCTATTCCATTTGTATTGTTTTTTTATGGACCTAGT
ATTCGACAAAGGAGTAAATTTTCGCGGAGGGTGTTGGAGGCGCAACAAAAAGCTTCTTTAGAGAAAATGTAG
Transcript >AgabiH97|019690
ATGAAGTTCGGTCAAAGCTATTTCTCTTATTTTCATGCTCATCCGGAGCCATCAAAGGATACCCATACCCCAGAC
CTAGAGAAGGATTCAACTTCAAAACTCACTCCTCTTGAACCGAAGGAAAATTCTCTGGATACGATAGCTCCTGAA
GAAACCATTTATGTTGAATATGAACCGAACGACTCAAGAAACCCTATCAATTTTCCTCGCGCGAAGAAATGGACG
ATAACTTTTGTCGCATCTGCTTCCACTTTGTTCACTTCCGCTACAGCGGCATCATACGCCTTAGGTTTCCCTTCA
ATGACACGCGATCTCTCTGCTACCCAGTTTCAAGCAACAGTCGGGCTCAGCATGTACACTCTAGGGTTTGGTGTA
GTGCCATTGGTCACTGCATCGTTCTCTGAGGAGTTTGGTCGACGGCCACTATATCTCGTCTCCGGACTCGGATTC
GCAATTTTCTATGTCATGATTGCTGAAGCAAAAAACATTCAAACCGTCATGGTGGCAAGACTCATACAAGGTTCA
TTTGGCTCTACAGCGGCGACGATGGTTGGTGGTACAATTGCAGACATTTGGGCACCTGCCGAGCGTGGTCTACCT
ATGGCTATCTTTTCGCTAAGTGCTCTATGCGGGAACGGTTATGGTCCTCTAATAGCGGGTTGGATCGAAATGAAT
TCACGACTTGGTTGGCGTTGGATACAATGGATTCAGCTCATCATTTTCGCTGTTACTCTCTTATTAGTCTTTATA
TTCCTTGAAGAGACCCGTTCTACTGTGCTCTTGATGCGTATAGCGAAGAAATTGAGAGAAGAGACAGGTCGAAGT
TACAAGGCGAGAATAGAAGATGAGAGTGTGAGTTTGAAACATCTCATTTGGATTTCTTGTACACGACCCATTCGT
CTATTACTTACGGAACATGTCGTCCTAAGTTTTAGCTTATGGATTGGTTTCGCTTGGGGTGTGACATATTGCATG
ATTCAATCTATTGGAATGGTTTTTCGGACTTTGCACGACTTTAATGACGGACAGGTTGGCCTAGTATTCATAAGT
ATGCTTGTGGGCTCTTTCATTGGATTTTTCTCGAATTTCTACCAAGAATACTTATACAAAATGTATTATCCAACG
AGAGGCCCAGAAGCACGTCTCTATTGTGCTTGTGTAGCAGCATTTTTCTTGCCGATAGCGATGTTCATATATGCC
TGGTGTTCATTCTCACATGTTCATTGGATAGGTTTGGTCGTTGGTATCACATTATTCGTGGCTGCTATGTTTGTT
GTGTACCTTGCAGTTTTCTCATATCTCGCCGATTGTTATGGTCCCTATGCATCATCCGCTCTTGCAGGTCAAAGT
CTTGCTCGTAACATAATGGCAACAGTTTTTCCTCTATTCACAACTCAAATGTATACCAACCTAACATTCAAATGG
GCAAATACCTTGTTCGGATTTTTAGCTTTGGCTATGATACCTATTCCATTTGTATTGTTTTTTTATGGACCTAGT
ATTCGACAAAGGAGTAAATTTTCGCGGAGGGTGTTGGAGGCGCAACAAAAAGCTTCTTTAGAGAAAATGTAG
Gene >AgabiH97|019690
ATGAAGTTCGGTCAAAGCTATTTCTCTTATTTTCATGCTCATCCGGAGCCATCAAAGGATACCCATACCCCAGAC
CTAGAGAAGGATTCAACTTCAAAACTCACTCCTCTTGAACCGAAGGAAAATTCTCTGGATACGATAGCTCCTGAA
GAAACCATTTATGTGGGTGACAATGCTACTCTGCGACTGTATGATATAACTTTTATTACAGGTTGAATATGAACC
GAACGACTCAAGAAACCCTATCAATTTTCCTCGCGCGAAGAAATGGACGATAACTTTTGTCGCATCTGCTTCCAC
TTTGTTCACTTGTGCGCTACTTTCAATATTACACTGAGGTCTCGCCGTATAACCTCGTTTTTTGTTTTGATTTGG
TAGCCGCTACAGCGGCATCATACGCCTTAGGTTTCCCTTCAATGACACGCGATCTCTCTGCTACCCAGTTTCAAG
CAACAGTCGGGCTCAGCATGTACACTCTAGGGTTTGGTGTAGTGCCATTGGTCACTGCATCGTTCTCTGAGGAGT
TTGGTCGACGGCCACTATATCTCGTCTCCGGACTCGGATTCGCAATTTTCTATGTCATGATTGCTGAGTATGTCA
TCAATTTACTGCTTATTCTTTTTACCGAACGTGTCTTATTAATCTCTCCTAGAGCAAAAAACATTCAAACCGTCA
TGGTGGCAAGACTCATACAAGGTTCATTTGGCTCTACAGCGGCGACGATGGTTGGTGGTACAATTGCAGACATTT
GGGCACCTGCCGAGTACGTTACATATCCGTTTCTCTGATCATATCTAACAACCTTGACAGGCGTGGTCTACCTAT
GGCTATCTTTTCGCTAAGTGCTCTATGCGGGAACGGTTATGGTCCTCTAATAGCGGGTTGGATCGAAATGAATTC
ACGACTTGGTTGGCGTTGGATACAATGGATTCAGCTCATGTACGTGAAACTCTTTTCCTTACACCCACGTACATT
CTCAGCCTAATCAATAAAAATCATAACAGCATTTTCGCTGTTACTCTCTTATTAGTCTTTATATTCCTTGAAGAG
ACCCGTTCTACTGTGCTCTTGATGCGTATAGCGAAGAAATTGAGAGAAGAGACAGGTCGAAGTTACAAGGCGAGA
ATAGAAGATGAGAGTGTGAGTTTGAAACATCTCATTTGGATTTCTTGTACACGACCCATTCGTAAGTTCTATTTC
TTCTTTTTTATGATGTAACCTGACACATCGGGTTCTTCAAGGTCTATTACTTACGGAACATGTCGTCCTAAGTTT
TAGCGTAAGTCCCAGCTACACCCTACCTATGCACATGCTCGAAATCTAATCTATACCCACTCCAGTTATGGATTG
GTTTCGCTTGGGGTGTGACATATTGCATGATTCAGTATGTTGCATTTAACTCTCAGATTTTCATTGTTCGAAATG
CTGAAAAAAATCTTGACTAATTTAGATCTATTGGAATGGTTTTTCGGACTTTGCACGACTTTAATGACGGACAGG
TTGGCCTAGTATTCATAAGTATGCTGTAAGTCTACCATGAATTTCCTTCCTACAAAATTCGAGAACTCACAAAAA
CGTCTCAGTGTGGGCTCTTTCATTGGATTTTTCTCGAATTTCTACCAAGAATACTTATACAAGTACGGCAGACAC
TCTTCTCATCCCCCCCCGGAAAACGCTCACATAAATCATCGATAACAGAATGTATTATCCAACGAGAGGCCCAGA
AGCACGTCTCTATTGTGCTTGTGTAGCAGCATTTTTCTTGCCGATAGCGATGTTCATATATGCCTGGTGTTCATT
CTCACATGTTCATTGGATAGGTTTGGTCGTTGGTATCACAGTACGTACAAGTGGTCATCTCTTTTTTTCGATATA
TATGTATACTTATTCTTTTTCAGTTATTCGTGGCTGCTATGTTTGTTGTGTACCTTGCAGTTTTCTCATATCTCG
CCGATTGGTAACGTATTTCTTTAAATTCCCAAGGAAAACTTCGTACTCACATACCTACTTTTCAAAGTTATGGTC
CCTATGCATCATCCGCTCTTGCAGGTCAAAGTCTTGCTCGTACGTATCTACCATTCTCAACATACCCCTGACACA
AGCGTAACTTTTTTTCTAATAAAAACAGGTAACATAATGGCAACAGTTTTTCCTCTATTCACAACTCAAATGTAT
ACCAACCTAACATTCAAATGGGCAAATACCTTGTTCGGATTTTTAGCTTTGGCTATGATACCTATTCCATTTGTA
AGTCGTTCGTTTCGTTTTCGTTTTCGTTAACTCGTGTTTTTTTTTAATGAATATATATCGAATGTGTTGTAGGTA
TTGTTTTTTTATGGACCTAGTATTCGACAAAGGAGTAAATTTTCGCGGAGGGTGTTGGAGGCGCAACAAAAAGCT
TCTTTAGAGAAAATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail