Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|019530
Gene name
Locationscaffold_10:1219838..1221499
Strand+
Gene length (bp)1661
Transcript length (bp)1614
Coding sequence length (bp)1614
Protein length (aa) 538

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02992 Transposase_21 Transposase family tnp2 3.9E-25 346 474

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|019530
MSGPQASTSSRKRSKIPCSCGCGKIVAYSTQSAHLRGRTRPEITAAISETTRYLRGEDDSLEGSSSNKRSNPPDV
VHQDTPRKRQRMLTAAAPPSTNGQSDVQIRAGENIGHDGGGNNEDEDDEDEGDIYDEEEEEEEEEEEEEEDRGDN
EANGEGGGIVLEEAAEVALFSDWVEENFLRTASDIRLDNMDLLLLRKYMLKVRQHLTEKTFSLLRAVFPEFPQPS
LEVTKSRVQELSGFLAKHFSCCINSCICYVGPYKDLTQCPHCHEARRDAKGRPRQIFAYLPLVPRLQAMSSNLQH
ARKMSYRGDFQHEPGNMRDVFDGSHYQSLLTQVVPTDDPDSSCLYFSDKRDVALGLSTDGFAPFKQRNKTCWPMI
LFNYNLPPDIRFQKRYCISLGTIPGPKKPHDMDSFLWPLVQELRLLASGVKTFDPISQSLFLLHAYLIVIFGDIP
AIAMLMRMKGANGISPCRICNIKAVRGGGSNTYYVPLRRDTIPDADPKRYDPSVLPIRNHNELMAQAVEVDNARI
TRCARDLQKNMG*
Coding >AgabiH97|019530
ATGTCAGGTCCGCAGGCATCCACATCTTCGAGGAAGCGTTCAAAAATACCATGCTCGTGTGGTTGCGGCAAGATC
GTTGCGTATTCGACCCAGTCTGCGCACCTCAGAGGTCGGACAAGACCAGAGATCACGGCTGCAATATCGGAAACA
ACACGCTACTTACGAGGAGAGGATGACAGCCTAGAAGGAAGCTCATCTAACAAGCGCTCAAACCCGCCAGATGTT
GTTCACCAGGATACGCCAAGGAAGAGGCAGCGGATGCTTACTGCTGCGGCTCCTCCATCAACAAATGGACAATCC
GATGTGCAGATAAGAGCGGGTGAGAATATTGGCCACGATGGAGGAGGAAATAATGAAGATGAAGATGATGAAGAT
GAAGGAGATATCTACGACGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGATCGTGGTGATAAT
GAAGCTAATGGCGAGGGCGGGGGGATTGTACTAGAGGAGGCTGCGGAAGTGGCATTGTTCTCTGACTGGGTTGAA
GAAAACTTTCTACGTACAGCTTCAGATATTCGTCTTGACAATATGGACTTGCTTCTGCTCCGCAAATATATGCTG
AAGGTTCGACAACATTTGACCGAAAAAACGTTTTCTTTGCTACGGGCCGTCTTCCCTGAATTCCCACAACCTTCA
CTCGAAGTCACCAAAAGCCGCGTCCAAGAACTTTCAGGTTTCCTAGCAAAGCATTTCAGCTGTTGCATAAACAGC
TGTATCTGCTATGTCGGACCATACAAGGATTTGACACAGTGCCCACACTGCCACGAGGCGAGGCGTGATGCGAAA
GGCAGACCACGTCAAATCTTTGCCTACCTTCCACTCGTCCCTCGTCTCCAAGCCATGTCATCCAACCTCCAACAC
GCCAGAAAGATGAGCTATCGAGGAGATTTTCAGCATGAGCCAGGCAACATGAGGGACGTCTTCGACGGCTCTCAC
TACCAGTCTCTACTTACCCAAGTTGTCCCCACCGACGACCCGGATTCTTCTTGTCTCTATTTCTCCGACAAACGT
GATGTTGCGCTCGGGCTGTCAACTGACGGCTTTGCACCCTTCAAACAACGTAACAAAACATGCTGGCCCATGATA
CTTTTTAACTACAACCTTCCCCCCGACATTCGCTTTCAAAAACGCTATTGTATTAGTCTTGGGACGATCCCAGGG
CCAAAGAAGCCCCACGATATGGACTCGTTTCTGTGGCCATTGGTACAGGAACTTCGCCTTCTTGCATCTGGAGTT
AAAACTTTCGATCCCATCAGTCAATCTCTCTTTCTTCTTCATGCGTATTTAATTGTCATTTTTGGTGATATTCCT
GCAATTGCAATGCTAATGCGTATGAAAGGCGCGAATGGCATATCTCCCTGCCGAATTTGCAACATCAAAGCAGTT
CGTGGTGGTGGATCCAACACTTATTATGTCCCCTTACGACGAGACACAATTCCAGATGCCGACCCCAAACGATAC
GACCCATCAGTTCTTCCTATACGCAACCACAACGAGCTAATGGCACAAGCTGTTGAAGTTGACAATGCTCGAATA
ACACGATGCGCGAGAGACTTGCAAAAGAATATGGGATAA
Transcript >AgabiH97|019530
ATGTCAGGTCCGCAGGCATCCACATCTTCGAGGAAGCGTTCAAAAATACCATGCTCGTGTGGTTGCGGCAAGATC
GTTGCGTATTCGACCCAGTCTGCGCACCTCAGAGGTCGGACAAGACCAGAGATCACGGCTGCAATATCGGAAACA
ACACGCTACTTACGAGGAGAGGATGACAGCCTAGAAGGAAGCTCATCTAACAAGCGCTCAAACCCGCCAGATGTT
GTTCACCAGGATACGCCAAGGAAGAGGCAGCGGATGCTTACTGCTGCGGCTCCTCCATCAACAAATGGACAATCC
GATGTGCAGATAAGAGCGGGTGAGAATATTGGCCACGATGGAGGAGGAAATAATGAAGATGAAGATGATGAAGAT
GAAGGAGATATCTACGACGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGATCGTGGTGATAAT
GAAGCTAATGGCGAGGGCGGGGGGATTGTACTAGAGGAGGCTGCGGAAGTGGCATTGTTCTCTGACTGGGTTGAA
GAAAACTTTCTACGTACAGCTTCAGATATTCGTCTTGACAATATGGACTTGCTTCTGCTCCGCAAATATATGCTG
AAGGTTCGACAACATTTGACCGAAAAAACGTTTTCTTTGCTACGGGCCGTCTTCCCTGAATTCCCACAACCTTCA
CTCGAAGTCACCAAAAGCCGCGTCCAAGAACTTTCAGGTTTCCTAGCAAAGCATTTCAGCTGTTGCATAAACAGC
TGTATCTGCTATGTCGGACCATACAAGGATTTGACACAGTGCCCACACTGCCACGAGGCGAGGCGTGATGCGAAA
GGCAGACCACGTCAAATCTTTGCCTACCTTCCACTCGTCCCTCGTCTCCAAGCCATGTCATCCAACCTCCAACAC
GCCAGAAAGATGAGCTATCGAGGAGATTTTCAGCATGAGCCAGGCAACATGAGGGACGTCTTCGACGGCTCTCAC
TACCAGTCTCTACTTACCCAAGTTGTCCCCACCGACGACCCGGATTCTTCTTGTCTCTATTTCTCCGACAAACGT
GATGTTGCGCTCGGGCTGTCAACTGACGGCTTTGCACCCTTCAAACAACGTAACAAAACATGCTGGCCCATGATA
CTTTTTAACTACAACCTTCCCCCCGACATTCGCTTTCAAAAACGCTATTGTATTAGTCTTGGGACGATCCCAGGG
CCAAAGAAGCCCCACGATATGGACTCGTTTCTGTGGCCATTGGTACAGGAACTTCGCCTTCTTGCATCTGGAGTT
AAAACTTTCGATCCCATCAGTCAATCTCTCTTTCTTCTTCATGCGTATTTAATTGTCATTTTTGGTGATATTCCT
GCAATTGCAATGCTAATGCGTATGAAAGGCGCGAATGGCATATCTCCCTGCCGAATTTGCAACATCAAAGCAGTT
CGTGGTGGTGGATCCAACACTTATTATGTCCCCTTACGACGAGACACAATTCCAGATGCCGACCCCAAACGATAC
GACCCATCAGTTCTTCCTATACGCAACCACAACGAGCTAATGGCACAAGCTGTTGAAGTTGACAATGCTCGAATA
ACACGATGCGCGAGAGACTTGCAAAAGAATATGGGATAA
Gene >AgabiH97|019530
ATGTCAGGTCCGCAGGCATCCACATCTTCGAGGAAGCGTTCAAAAATACCATGCTCGTGTGGTTGCGGCAAGATC
GTTGCGTATTCGACCCAGTCTGCGCACCTCAGAGGTCGGACAAGACCAGAGATCACGGCTGCAATATCGGAAACA
ACACGCTACTTACGAGGAGAGGATGACAGCCTAGAAGGAAGCTCATCTAACAAGCGCTCAAACCCGCCAGATGTT
GTTCACCAGGATACGCCAAGGAAGAGGCAGCGGATGCTTACTGCTGCGGCTCCTCCATCAACAAATGGACAATCC
GATGTGCAGATAAGAGCGGGTGAGAATATTGGCCACGATGGAGGAGGAAATAATGAAGATGAAGATGATGAAGAT
GAAGGAGATATCTACGACGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGATCGTGGTGATAAT
GAAGCTAATGGCGAGGGCGGGGGGATTGTACTAGAGGAGGCTGCGGAAGTGGCATTGTTCTCTGACTGGGTTGAA
GAAAACTTTCTACGTACAGCTTCAGGTAAAATTTCCCCTATCCAGGTTTGAATTCTACTGACGAGGATGTAGATA
TTCGTCTTGACAATATGGACTTGCTTCTGCTCCGCAAATATATGCTGAAGGTTCGACAACATTTGACCGAAAAAA
CGTTTTCTTTGCTACGGGCCGTCTTCCCTGAATTCCCACAACCTTCACTCGAAGTCACCAAAAGCCGCGTCCAAG
AACTTTCAGGTTTCCTAGCAAAGCATTTCAGCTGTTGCATAAACAGCTGTATCTGCTATGTCGGACCATACAAGG
ATTTGACACAGTGCCCACACTGCCACGAGGCGAGGCGTGATGCGAAAGGCAGACCACGTCAAATCTTTGCCTACC
TTCCACTCGTCCCTCGTCTCCAAGCCATGTCATCCAACCTCCAACACGCCAGAAAGATGAGCTATCGAGGAGATT
TTCAGCATGAGCCAGGCAACATGAGGGACGTCTTCGACGGCTCTCACTACCAGTCTCTACTTACCCAAGTTGTCC
CCACCGACGACCCGGATTCTTCTTGTCTCTATTTCTCCGACAAACGTGATGTTGCGCTCGGGCTGTCAACTGACG
GCTTTGCACCCTTCAAACAACGTAACAAAACATGCTGGCCCATGATACTTTTTAACTACAACCTTCCCCCCGACA
TTCGCTTTCAAAAACGCTATTGTATTAGTCTTGGGACGATCCCAGGGCCAAAGAAGCCCCACGATATGGACTCGT
TTCTGTGGCCATTGGTACAGGAACTTCGCCTTCTTGCATCTGGAGTTAAAACTTTCGATCCCATCAGTCAATCTC
TCTTTCTTCTTCATGCGTATTTAATTGTCATTTTTGGTGATATTCCTGCAATTGCAATGCTAATGCGTATGAAAG
GCGCGAATGGCATATCTCCCTGCCGAATTTGCAACATCAAAGCAGTTCGTGGTGGTGGATCCAACACTTATTATG
TCCCCTTACGACGAGACACAATTCCAGATGCCGACCCCAAACGATACGACCCATCAGTTCTTCCTATACGCAACC
ACAACGAGCTAATGGCACAAGCTGTTGAAGTTGACAATGCTCGAATAACACGATGCGCGAGAGACTTGCAAAAGA
ATATGGGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail