Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|019330
Gene name
Locationscaffold_10:1165098..1166217
Strand+
Gene length (bp)1119
Transcript length (bp)768
Coding sequence length (bp)768
Protein length (aa) 256

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16 1.7E-05 120 162

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|F7J1C8|E3GAL_FLAVE Galactan endo-beta-1,3-galactanase OS=Flammulina velutipes GN=EN3GAL PE=1 SV=1 18 254 7.0E-112

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 39.94 19.36 60.52
Initials Initials knots 11.70 5.32 18.07
Pileal_Stipeal_center Stage I stipe center 14.12 6.60 21.65
Pileal_Stipeal_shell Stage I stipe shell 15.37 7.27 23.46
DIF_stipe_center Stage II stipe center 10.62 4.75 16.49
DIF_stipe_shell Stage II stipe shell 14.74 6.94 22.54
DIF_stipe_skin Stage II stipe skin 15.49 7.35 23.63
DIF_cap_skin Stage II cap skin 17.43 8.41 26.46
DIF_cap_tissue Stage II cap tissue 15.87 7.53 24.21
DIF_gill_tissue Stage II gill tissue 15.59 7.37 23.81
YFB_stipe_center Young fruiting body stipe center 10.54 4.70 16.38
YFB_stipe_shell Young fruiting body stipe shell 13.21 6.07 20.35
YFB_stipe_skin Young fruiting body stipe skin 16.05 7.66 24.44
YFB_cap_skin Young fruiting body cap skin 14.83 6.98 22.69
YFB_cap_tissue Young fruiting body cap tissue 17.02 8.12 25.92
YFB_gill_tissue Young fruiting body gill tissue 13.74 6.42 21.06
YFB_veil Young fruiting body veil 15.15 7.17 23.13

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.003365 yes
Casing YFB_stipe_center 0.000613 yes
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.004928 yes
Casing YFB_cap_skin 0.002084 yes
Casing YFB_cap_tissue 0.009773 yes
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.002084 yes
Casing Initials 0.000613 yes
Casing Pileal_Stipeal_center 0.000613 yes
Casing Pileal_Stipeal_shell 0.003365 yes
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.001140 yes
Casing DIF_stipe_skin 0.004548 yes
Casing DIF_cap_skin 0.014668 yes
Casing DIF_cap_tissue 0.004548 yes
DIF_gill_tissue YFB_stipe_center 0.363455 no
DIF_gill_tissue YFB_stipe_shell 0.777811 no
DIF_gill_tissue YFB_stipe_skin 0.965601 no
DIF_gill_tissue YFB_cap_skin 0.944165 no
DIF_gill_tissue YFB_cap_tissue 0.892349 no
DIF_gill_tissue YFB_gill_tissue 0.837042 no
DIF_gill_tissue YFB_veil 0.967645 no
YFB_stipe_center YFB_stipe_shell 0.676781 no
YFB_stipe_center YFB_stipe_skin 0.319049 no
YFB_stipe_center YFB_cap_skin 0.447487 no
YFB_stipe_center YFB_cap_tissue 0.235278 no
YFB_stipe_center YFB_gill_tissue 0.583920 no
YFB_stipe_center YFB_veil 0.407303 no
YFB_stipe_shell YFB_stipe_skin 0.725446 no
YFB_stipe_shell YFB_cap_skin 0.853996 no
YFB_stipe_shell YFB_cap_tissue 0.614639 no
YFB_stipe_shell YFB_gill_tissue 0.957106 no
YFB_stipe_shell YFB_veil 0.821168 no
YFB_stipe_skin YFB_cap_skin 0.906826 no
YFB_stipe_skin YFB_cap_tissue 0.932902 no
YFB_stipe_skin YFB_gill_tissue 0.785448 no
YFB_stipe_skin YFB_veil 0.933372 no
YFB_cap_skin YFB_cap_tissue 0.814805 no
YFB_cap_skin YFB_gill_tissue 0.907846 no
YFB_cap_skin YFB_veil 0.976350 no
YFB_cap_tissue YFB_gill_tissue 0.674636 no
YFB_cap_tissue YFB_veil 0.848355 no
YFB_gill_tissue YFB_veil 0.878078 no
Initials DIF_gill_tissue 0.553272 no
Initials YFB_stipe_center 0.874634 no
Initials YFB_stipe_shell 0.851128 no
Initials YFB_stipe_skin 0.499546 no
Initials YFB_cap_skin 0.645826 no
Initials YFB_cap_tissue 0.389457 no
Initials YFB_gill_tissue 0.781586 no
Initials YFB_veil 0.604968 no
Initials Pileal_Stipeal_center 0.732490 no
Initials Pileal_Stipeal_shell 0.579097 no
Initials DIF_stipe_center 0.883873 no
Initials DIF_stipe_shell 0.654284 no
Initials DIF_stipe_skin 0.564856 no
Initials DIF_cap_skin 0.358317 no
Initials DIF_cap_tissue 0.519646 no
Pileal_Stipeal_center DIF_gill_tissue 0.876871 no
Pileal_Stipeal_center YFB_stipe_center 0.533464 no
Pileal_Stipeal_center YFB_stipe_shell 0.925513 no
Pileal_Stipeal_center YFB_stipe_skin 0.831541 no
Pileal_Stipeal_center YFB_cap_skin 0.945206 no
Pileal_Stipeal_center YFB_cap_tissue 0.726289 no
Pileal_Stipeal_center YFB_gill_tissue 0.969973 no
Pileal_Stipeal_center YFB_veil 0.919104 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.895824 no
Pileal_Stipeal_center DIF_stipe_center 0.550251 no
Pileal_Stipeal_center DIF_stipe_shell 0.951788 no
Pileal_Stipeal_center DIF_stipe_skin 0.885026 no
Pileal_Stipeal_center DIF_cap_skin 0.680223 no
Pileal_Stipeal_center DIF_cap_tissue 0.847555 no
Pileal_Stipeal_shell DIF_gill_tissue 0.983523 no
Pileal_Stipeal_shell YFB_stipe_center 0.382982 no
Pileal_Stipeal_shell YFB_stipe_shell 0.794489 no
Pileal_Stipeal_shell YFB_stipe_skin 0.948846 no
Pileal_Stipeal_shell YFB_cap_skin 0.958744 no
Pileal_Stipeal_shell YFB_cap_tissue 0.868518 no
Pileal_Stipeal_shell YFB_gill_tissue 0.854494 no
Pileal_Stipeal_shell YFB_veil 0.982888 no
Pileal_Stipeal_shell DIF_stipe_center 0.396897 no
Pileal_Stipeal_shell DIF_stipe_shell 0.951182 no
Pileal_Stipeal_shell DIF_stipe_skin 0.990332 no
Pileal_Stipeal_shell DIF_cap_skin 0.832250 no
Pileal_Stipeal_shell DIF_cap_tissue 0.962620 no
DIF_stipe_center DIF_gill_tissue 0.365801 no
DIF_stipe_center YFB_stipe_center 0.991294 no
DIF_stipe_center YFB_stipe_shell 0.686379 no
DIF_stipe_center YFB_stipe_skin 0.322151 no
DIF_stipe_center YFB_cap_skin 0.456864 no
DIF_stipe_center YFB_cap_tissue 0.236682 no
DIF_stipe_center YFB_gill_tissue 0.596449 no
DIF_stipe_center YFB_veil 0.413186 no
DIF_stipe_center DIF_stipe_shell 0.462688 no
DIF_stipe_center DIF_stipe_skin 0.375368 no
DIF_stipe_center DIF_cap_skin 0.206339 no
DIF_stipe_center DIF_cap_tissue 0.337866 no
DIF_stipe_shell DIF_gill_tissue 0.933861 no
DIF_stipe_shell YFB_stipe_center 0.454137 no
DIF_stipe_shell YFB_stipe_shell 0.862025 no
DIF_stipe_shell YFB_stipe_skin 0.893715 no
DIF_stipe_shell YFB_cap_skin 0.992322 no
DIF_stipe_shell YFB_cap_tissue 0.800113 no
DIF_stipe_shell YFB_gill_tissue 0.916413 no
DIF_stipe_shell YFB_veil 0.969096 no
DIF_stipe_shell DIF_stipe_skin 0.941300 no
DIF_stipe_shell DIF_cap_skin 0.762306 no
DIF_stipe_shell DIF_cap_tissue 0.909379 no
DIF_stipe_skin DIF_gill_tissue 0.992245 no
DIF_stipe_skin YFB_stipe_center 0.369699 no
DIF_stipe_skin YFB_stipe_shell 0.785863 no
DIF_stipe_skin YFB_stipe_skin 0.959159 no
DIF_stipe_skin YFB_cap_skin 0.949998 no
DIF_stipe_skin YFB_cap_tissue 0.883687 no
DIF_stipe_skin YFB_gill_tissue 0.844925 no
DIF_stipe_skin YFB_veil 0.974267 no
DIF_stipe_skin DIF_cap_skin 0.850158 no
DIF_stipe_skin DIF_cap_tissue 0.972633 no
DIF_cap_skin DIF_gill_tissue 0.858347 no
DIF_cap_skin YFB_stipe_center 0.200323 no
DIF_cap_skin YFB_stipe_shell 0.573210 no
DIF_cap_skin YFB_stipe_skin 0.900393 no
DIF_cap_skin YFB_cap_skin 0.778398 no
DIF_cap_skin YFB_cap_tissue 0.973184 no
DIF_cap_skin YFB_gill_tissue 0.636616 no
DIF_cap_skin YFB_veil 0.813681 no
DIF_cap_skin DIF_cap_tissue 0.882336 no
DIF_cap_tissue DIF_gill_tissue 0.979951 no
DIF_cap_tissue YFB_stipe_center 0.330826 no
DIF_cap_tissue YFB_stipe_shell 0.739518 no
DIF_cap_tissue YFB_stipe_skin 0.987173 no
DIF_cap_tissue YFB_cap_skin 0.920446 no
DIF_cap_tissue YFB_cap_tissue 0.916321 no
DIF_cap_tissue YFB_gill_tissue 0.802367 no
DIF_cap_tissue YFB_veil 0.946622 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|019330
MFLPTTAAFLFFAASTGVQAATVIPSNSFSSVSTFQTYWNYLYPWGSDHNGSARMRGSSSDHSHINPASGTLSLI
ATPTSNPSPPTSGSDPHPAIHYASGAVHAKSQITVTRSTGYTISGEFSAPTARGTWPAFWLTAVNSWPPEVDIGE
WKGTNQNWFNTFNTSSSVKSNLVNWPGDLSFHSLKAVLSAESNGADVKIDFYMDNTLRTTQFGKGFVGKPLWLII
NLQMEGSAGSPGPSGTTTYKIRNVQVTNTA*
Coding >AgabiH97|019330
ATGTTCTTACCGACTACTGCTGCGTTCCTTTTCTTCGCTGCTTCTACAGGAGTTCAGGCTGCGACGGTCATACCG
TCCAACTCTTTCTCCTCGGTCTCAACCTTCCAGACCTATTGGAACTATCTCTATCCATGGGGTTCAGACCACAAT
GGCAGTGCAAGGATGAGGGGGAGCTCATCTGACCATAGTCATATCAACCCAGCGTCGGGAACTCTTAGTTTGATA
GCTACACCAACATCAAACCCCTCGCCCCCAACGAGTGGTTCTGACCCTCACCCGGCAATACACTACGCTAGTGGC
GCAGTCCATGCAAAAAGTCAGATCACGGTGACCAGATCAACCGGATATACTATCTCCGGTGAATTTAGTGCCCCA
ACAGCCAGAGGCACCTGGCCCGCATTCTGGTTAACTGCTGTAAATAGCTGGCCTCCTGAAGTCGATATCGGTGAA
TGGAAAGGCACAAATCAAAACTGGTTCAACACCTTCAATACCTCTTCTAGCGTCAAATCCAACTTAGTCAACTGG
CCCGGTGACCTCTCCTTCCATTCACTCAAAGCAGTGCTCTCAGCAGAGTCAAATGGAGCCGATGTCAAGATTGAC
TTTTACATGGACAACACCCTTCGCACGACTCAATTTGGTAAAGGATTCGTCGGAAAACCCCTCTGGTTGATTATT
AACTTGCAGATGGAGGGATCCGCGGGCTCTCCCGGCCCGTCGGGTACGACGACGTACAAAATTCGCAACGTGCAA
GTCACTAACACTGCATGA
Transcript >AgabiH97|019330
ATGTTCTTACCGACTACTGCTGCGTTCCTTTTCTTCGCTGCTTCTACAGGAGTTCAGGCTGCGACGGTCATACCG
TCCAACTCTTTCTCCTCGGTCTCAACCTTCCAGACCTATTGGAACTATCTCTATCCATGGGGTTCAGACCACAAT
GGCAGTGCAAGGATGAGGGGGAGCTCATCTGACCATAGTCATATCAACCCAGCGTCGGGAACTCTTAGTTTGATA
GCTACACCAACATCAAACCCCTCGCCCCCAACGAGTGGTTCTGACCCTCACCCGGCAATACACTACGCTAGTGGC
GCAGTCCATGCAAAAAGTCAGATCACGGTGACCAGATCAACCGGATATACTATCTCCGGTGAATTTAGTGCCCCA
ACAGCCAGAGGCACCTGGCCCGCATTCTGGTTAACTGCTGTAAATAGCTGGCCTCCTGAAGTCGATATCGGTGAA
TGGAAAGGCACAAATCAAAACTGGTTCAACACCTTCAATACCTCTTCTAGCGTCAAATCCAACTTAGTCAACTGG
CCCGGTGACCTCTCCTTCCATTCACTCAAAGCAGTGCTCTCAGCAGAGTCAAATGGAGCCGATGTCAAGATTGAC
TTTTACATGGACAACACCCTTCGCACGACTCAATTTGGTAAAGGATTCGTCGGAAAACCCCTCTGGTTGATTATT
AACTTGCAGATGGAGGGATCCGCGGGCTCTCCCGGCCCGTCGGGTACGACGACGTACAAAATTCGCAACGTGCAA
GTCACTAACACTGCATGA
Gene >AgabiH97|019330
ATGTTCTTACCGACTACTGCTGCGTTCCTTTTCTTCGCTGCTTCTACAGGAGTTCAGGCTGCGACGGTCATACCG
TCCAACTCTTTCTCCTCGGTCTCAACCTTCCAGACCTATTGGAACTATCTCTATCCATGGGGTTCAGACCACAAT
GGCAGTACGTCTGTTATTGCTTTGCCATTATACATCATTCATCTGTATCATAAGGTGCAAGGATGAGGGGGAGCT
CATCTGACCATAGTCATATCAACCCAGCGTCGGGAACTCTTAGTTTGATAGCTACACCAACATCAAACCCCTCGC
CCCCAACGAGTGGTTCTGACCCTCACCCGGCAATACACTACGCTAGGTAATATCAGAGAGAGAAATAATATCGTC
GACCGAATTTAACGCTGACGATCACCCTTAGTGGCGCAGTCCATGCAAAAAGTCAGATCACGGTGACCAGATCAA
CCGGATATACTATCTCCGGTGAATTTAGTGCCCCAACAGCCAGAGGCACCTGGCCCGCATTCTGGTGAATAAACA
CGCAAGACTTGCTTTTTTGACATCATGCTCACATGGCTATGTCCCGAATTGCAGGTTAACTGTAAGTTCGACTGT
CATTTCTGATATATCCTTTCCGCGTCTTACAAGTTACGATGTTTCACTAGGCTGTAAATAGCTGGCCTCCTGAAG
TCGATATCGGTGAATGGAAAGGCACAAATCAAAACTGGTTCAACACCTTCAATACCTCTTCTAGCGTCAAATCCA
ACTTAGTCAACTGGCCCGGTGACCTCTCCTTCCATTCACTCAAAGCAGTGCTCTCAGCAGAGTCAAATGGAGCCG
ATGTCAAGATTGACTTTTACATGGACAACACCCTTCGCACGACTCAATTTGGTAAAGGATTCGTCGGAAAACCCC
TCTGGTTGTATGTGATCTTTCGCTACTTTTTATTGTAAAATGGTGGGCTGATGTTCTTAATGATAGGATTATTAA
CTTGCAGGTATGCACGGCCTATTCCATATATTCGCGCCAGCAGATTGAATGTTGCATTAGATGGAGGGATCCGCG
GGCTCTCCCGGCCCGTCGGGTACGACGACGTACAAAATTCGCAACGTGCAAGTCACTAACACTGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail