Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|019280
Gene name
Locationscaffold_10:1147376..1148633
Strand+
Gene length (bp)1257
Transcript length (bp)861
Coding sequence length (bp)861
Protein length (aa) 287

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09729 Gti1_Pac2 Gti1/Pac2 family 4.4E-16 22 83

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38867|YHX7_YEAST Uncharacterized protein YHR177W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHR177W PE=1 SV=2 17 159 2.0E-08
sp|Q10294|PAC2_SCHPO cAMP-independent regulatory protein pac2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pac2 PE=2 SV=1 10 182 4.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|019280
MILTLFGCPVLLPLSCNVRLSKMRLDAEERRAIIPGNVYVWEERGANTEPTGLGMERWTDGMGWGPSRVRDEFLF
YHQKEADLNDDGINPVTPWAQMMRHSTSRPSNRPYTLDSRITPESERLIKQTYSVHVSLPADRPRGIVRKWHLTA
YFSQNKLDELRTVDEIHGIGDVSVPEGWFKSARVGKTRRDSRAQGGNAHPGDAAPQSTTPPFYSYPLGSPTSQQR
HAPAHPHSSPSPSSHSSTTSSPSIHNGGHPTGHLVPLEYLQNMSAPRRDPNDEQLLRRFSS*
Coding >AgabiH97|019280
ATGATACTCACCCTCTTTGGTTGCCCTGTTTTGCTCCCTCTATCATGCAACGTCCGACTCTCCAAAATGCGCTTA
GATGCTGAAGAGAGACGAGCTATTATTCCAGGAAACGTATACGTTTGGGAGGAACGTGGTGCCAACACAGAGCCT
ACTGGCCTTGGTATGGAGCGGTGGACGGACGGCATGGGCTGGGGTCCCAGTCGTGTGAGAGACGAATTCTTGTTT
TACCATCAGAAAGAGGCAGACCTCAATGATGATGGAATCAACCCTGTAACCCCATGGGCACAGATGATGAGGCAT
TCAACCTCACGTCCATCGAACAGACCCTACACTCTGGATTCCAGGATTACTCCAGAATCTGAGCGTTTGATAAAA
CAGACCTATAGTGTCCATGTCTCTCTACCCGCAGATCGGCCTCGGGGCATCGTCCGGAAATGGCATCTGACTGCA
TATTTTAGTCAAAACAAGCTCGATGAGCTACGGACGGTGGATGAGATACATGGTATTGGAGATGTATCAGTACCA
GAGGGATGGTTCAAGAGTGCGCGTGTTGGAAAGACACGGCGAGATAGCCGAGCACAAGGTGGCAATGCCCACCCA
GGCGACGCTGCTCCACAATCCACGACTCCTCCTTTTTACAGTTATCCTCTTGGGTCTCCAACTTCACAGCAACGA
CATGCTCCGGCTCATCCACACTCTTCACCCAGTCCATCCAGTCATTCAAGTACTACGTCATCACCATCAATTCAT
AACGGTGGTCACCCGACAGGGCACCTTGTGCCCCTTGAATACCTACAAAACATGTCCGCTCCTCGGAGGGATCCG
AACGATGAACAATTGCTTCGTCGGTTCTCTTCGTGA
Transcript >AgabiH97|019280
ATGATACTCACCCTCTTTGGTTGCCCTGTTTTGCTCCCTCTATCATGCAACGTCCGACTCTCCAAAATGCGCTTA
GATGCTGAAGAGAGACGAGCTATTATTCCAGGAAACGTATACGTTTGGGAGGAACGTGGTGCCAACACAGAGCCT
ACTGGCCTTGGTATGGAGCGGTGGACGGACGGCATGGGCTGGGGTCCCAGTCGTGTGAGAGACGAATTCTTGTTT
TACCATCAGAAAGAGGCAGACCTCAATGATGATGGAATCAACCCTGTAACCCCATGGGCACAGATGATGAGGCAT
TCAACCTCACGTCCATCGAACAGACCCTACACTCTGGATTCCAGGATTACTCCAGAATCTGAGCGTTTGATAAAA
CAGACCTATAGTGTCCATGTCTCTCTACCCGCAGATCGGCCTCGGGGCATCGTCCGGAAATGGCATCTGACTGCA
TATTTTAGTCAAAACAAGCTCGATGAGCTACGGACGGTGGATGAGATACATGGTATTGGAGATGTATCAGTACCA
GAGGGATGGTTCAAGAGTGCGCGTGTTGGAAAGACACGGCGAGATAGCCGAGCACAAGGTGGCAATGCCCACCCA
GGCGACGCTGCTCCACAATCCACGACTCCTCCTTTTTACAGTTATCCTCTTGGGTCTCCAACTTCACAGCAACGA
CATGCTCCGGCTCATCCACACTCTTCACCCAGTCCATCCAGTCATTCAAGTACTACGTCATCACCATCAATTCAT
AACGGTGGTCACCCGACAGGGCACCTTGTGCCCCTTGAATACCTACAAAACATGTCCGCTCCTCGGAGGGATCCG
AACGATGAACAATTGCTTCGTCGGTTCTCTTCGTGA
Gene >AgabiH97|019280
ATGATACTCACCCTCTTTGGTTGCCCTGTTTTGCTCCCTCTATCATGCAACGTCCGACTCTCCAAAATGTTCGTA
TACGCTCTACTCGTGATGCCCTCCAACTTTTCAACGGCGTCGCTGCAAATCGGTTGCCTCTCATTACCAGGCGCT
TAGATGCTGAAGAGAGACGAGCTATTATTCCAGGAAACGTATACGTTTGGTCAGTCGCCCTCCTTTAAAAAAAAA
CTTTTGATTGACAGCGACGACTTAAGGGAGGAACGTGGTGCCAACACAGAGCCTACTGGCCTTGGTATGGAGCGG
TGGTAAGTCAATGACGTCCCCTCCTTTGAACTTTATTGATGAATTGAAGGACGGACGGCATGGGCTGGGGTCCCA
GTCGTGAGTAGTGGGTCCCTGTTCCTGCTCCAGGCTGTTGCTGATCTGTGAATTATCCAGGTGTGAGAGACGTAA
GGCTCATTGATCATACAATAGCGTGATATTGACTTTAGGTGACAGGAATTCTTGTTTTACCATCAGAAAGAGGCA
GACCTCAATGATGATGGAATCAACCCTGTAACCCCATGGGCACAGATGATGAGGTTAGTCGCGTTCTATTTTTTT
TTCGCGATTTGCTTTTGATAACCATACGACTCGTCCGTTCGAAGGCATTCAACCTCACGTCCATCGAACAGACCC
TACACTCTGGATTCCAGGATTACTCCAGAATCTGAGCGTTTGATAAAACAGACCTATAGTGTCCATGTCTCTCTA
CCCGCAGATCGGCCTCGGGGCATCGTCCGGAAATGGCATCTGAGTAAGTATAGTATGAAATATATCTATTCTCAA
TCCTAACAAGATGCAGCTGCATATTTTAGTCAAAACAAGCTCGATGAGCTACGGACGGTGGATGAGATACATGGT
ATTGGAGATGTATCAGTACCAGAGGGATGGTTCAAGAGTGCGCGTGTTGGAAAGACACGGCGAGATAGCCGAGCA
CAAGGTGGCAATGCCCACCCAGGCGACGCTGCTCCACAATCCACGACTCCTCCTTTTTACAGTTATCCTCTTGGG
TCTCCAACTTCACAGCAACGACATGCTCCGGCTCATCCACACTCTTCACCCAGTCCATCCAGTCATTCAAGTACT
ACGTCATCACCATCAATTCATAACGGTGGTCACCCGACAGGGCACCTTGTGCCCCTTGAATACCTACAAAACATG
TCCGCTCCTCGGAGGGATCCGAACGATGAACAATTGCTTCGTCGGTTCTCTTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail