Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|019260
Gene name
Locationscaffold_10:1143487..1145829
Strand+
Gene length (bp)2342
Transcript length (bp)1737
Coding sequence length (bp)1737
Protein length (aa) 579

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11875 DnaJ-like_C11_C DnaJ-like protein C11, C-terminal 1.0E-29 433 569
PF00226 DnaJ DnaJ domain 3.7E-17 16 80

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5U458|DJC11_MOUSE DnaJ homolog subfamily C member 11 OS=Mus musculus GN=Dnajc11 PE=1 SV=2 1 576 5.0E-39
sp|Q9NVH1|DJC11_HUMAN DnaJ homolog subfamily C member 11 OS=Homo sapiens GN=DNAJC11 PE=1 SV=2 1 576 4.0E-36
sp|Q5RC70|DJC11_PONAB DnaJ homolog subfamily C member 11 OS=Pongo abelii GN=DNAJC11 PE=2 SV=1 1 576 4.0E-36
sp|Q2NL21|DJC11_BOVIN DnaJ homolog subfamily C member 11 OS=Bos taurus GN=DNAJC11 PE=2 SV=1 1 576 3.0E-35
sp|Q39079|DNJ13_ARATH Chaperone protein dnaJ 13 OS=Arabidopsis thaliana GN=ATJ13 PE=1 SV=2 16 569 5.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5U458|DJC11_MOUSE DnaJ homolog subfamily C member 11 OS=Mus musculus GN=Dnajc11 PE=1 SV=2 1 576 5.0E-39
sp|Q9NVH1|DJC11_HUMAN DnaJ homolog subfamily C member 11 OS=Homo sapiens GN=DNAJC11 PE=1 SV=2 1 576 4.0E-36
sp|Q5RC70|DJC11_PONAB DnaJ homolog subfamily C member 11 OS=Pongo abelii GN=DNAJC11 PE=2 SV=1 1 576 4.0E-36
sp|Q2NL21|DJC11_BOVIN DnaJ homolog subfamily C member 11 OS=Bos taurus GN=DNAJC11 PE=2 SV=1 1 576 3.0E-35
sp|Q39079|DNJ13_ARATH Chaperone protein dnaJ 13 OS=Arabidopsis thaliana GN=ATJ13 PE=1 SV=2 16 569 5.0E-29
sp|Q9Y7T0|YCJ3_SCHPO Uncharacterized J domain-containing protein C63.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC63.03 PE=3 SV=2 371 575 6.0E-18
sp|Q54PV9|DJC11_DICDI DnaJ homolog subfamily C member 11 homolog OS=Dictyostelium discoideum GN=dnajc11 PE=3 SV=1 334 575 6.0E-16
sp|Q9D832|DNJB4_MOUSE DnaJ homolog subfamily B member 4 OS=Mus musculus GN=Dnajb4 PE=1 SV=1 12 87 1.0E-14
sp|Q9Y7T0|YCJ3_SCHPO Uncharacterized J domain-containing protein C63.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC63.03 PE=3 SV=2 10 157 2.0E-14
sp|Q5R8J8|DNJB4_PONAB DnaJ homolog subfamily B member 4 OS=Pongo abelii GN=DNAJB4 PE=2 SV=1 12 87 1.0E-13
sp|Q9UDY4|DNJB4_HUMAN DnaJ homolog subfamily B member 4 OS=Homo sapiens GN=DNAJB4 PE=1 SV=1 12 87 1.0E-13
sp|Q2KIT4|DNJB4_BOVIN DnaJ homolog subfamily B member 4 OS=Bos taurus GN=DNAJB4 PE=2 SV=1 12 87 2.0E-13
sp|O89114|DNJB5_MOUSE DnaJ homolog subfamily B member 5 OS=Mus musculus GN=Dnajb5 PE=2 SV=1 12 87 8.0E-12
sp|Q5BIP8|DNJB5_BOVIN DnaJ homolog subfamily B member 5 OS=Bos taurus GN=DNAJB5 PE=2 SV=1 12 87 1.0E-11
sp|O75953|DNJB5_HUMAN DnaJ homolog subfamily B member 5 OS=Homo sapiens GN=DNAJB5 PE=1 SV=1 12 87 1.0E-11
sp|A0Q1R3|DNAJ_CLONN Chaperone protein DnaJ OS=Clostridium novyi (strain NT) GN=dnaJ PE=3 SV=1 14 85 3.0E-11
sp|Q3MI00|DNJB1_BOVIN DnaJ homolog subfamily B member 1 OS=Bos taurus GN=DNAJB1 PE=2 SV=3 12 87 4.0E-11
sp|Q9LZK5|DNJ19_ARATH DnaJ protein ERDJ3B OS=Arabidopsis thaliana GN=ERDJ3B PE=1 SV=1 17 87 5.0E-11
sp|Q835R5|DNAJ_ENTFA Chaperone protein DnaJ OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=dnaJ PE=3 SV=1 14 86 7.0E-11
sp|Q0K758|DNAJ_CUPNH Chaperone protein DnaJ OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=dnaJ PE=3 SV=1 14 87 7.0E-11
sp|Q892R1|DNAJ_CLOTE Chaperone protein DnaJ OS=Clostridium tetani (strain Massachusetts / E88) GN=dnaJ PE=3 SV=1 16 85 2.0E-10
sp|A6LRN5|DNAJ_CLOB8 Chaperone protein DnaJ OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=dnaJ PE=3 SV=1 14 85 2.0E-10
sp|B2TLZ8|DNAJ_CLOBB Chaperone protein DnaJ OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=dnaJ PE=3 SV=1 14 85 3.0E-10
sp|A4SQ24|DNAJ_AERS4 Chaperone protein DnaJ OS=Aeromonas salmonicida (strain A449) GN=dnaJ PE=3 SV=1 16 87 3.0E-10
sp|B2V2I6|DNAJ_CLOBA Chaperone protein DnaJ OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=dnaJ PE=3 SV=1 14 85 3.0E-10
sp|B0TYF3|DNAJ_FRAP2 Chaperone protein DnaJ OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=dnaJ PE=3 SV=1 17 87 3.0E-10
sp|Q9QYI5|DNJB2_MOUSE DnaJ homolog subfamily B member 2 OS=Mus musculus GN=Dnajb2 PE=1 SV=2 17 99 4.0E-10
sp|B8HLD2|DNAJ_CYAP4 Chaperone protein DnaJ OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=dnaJ PE=3 SV=1 14 88 4.0E-10
sp|O59731|YHXB_SCHPO Uncharacterized J domain-containing protein C3E7.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3E7.11c PE=3 SV=1 14 86 4.0E-10
sp|Q5XGU5|DNJ6B_XENLA DnaJ homolog subfamily B member 6-B OS=Xenopus laevis GN=dnajb6-b PE=2 SV=1 17 88 5.0E-10
sp|B7JN38|DNAJ_BACC0 Chaperone protein DnaJ OS=Bacillus cereus (strain AH820) GN=dnaJ PE=3 SV=1 14 86 5.0E-10
sp|Q634M8|DNAJ_BACCZ Chaperone protein DnaJ OS=Bacillus cereus (strain ZK / E33L) GN=dnaJ PE=3 SV=1 14 86 5.0E-10
sp|C1ESK7|DNAJ_BACC3 Chaperone protein DnaJ OS=Bacillus cereus (strain 03BB102) GN=dnaJ PE=3 SV=1 14 86 5.0E-10
sp|Q6HDK8|DNAJ_BACHK Chaperone protein DnaJ OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dnaJ PE=3 SV=1 14 86 5.0E-10
sp|Q81LS3|DNAJ_BACAN Chaperone protein DnaJ OS=Bacillus anthracis GN=dnaJ PE=3 SV=1 14 86 5.0E-10
sp|C3L5R6|DNAJ_BACAC Chaperone protein DnaJ OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dnaJ PE=3 SV=1 14 86 5.0E-10
sp|C3P8L9|DNAJ_BACAA Chaperone protein DnaJ OS=Bacillus anthracis (strain A0248) GN=dnaJ PE=3 SV=1 14 86 5.0E-10
sp|P50027|DNAJH_SYNY3 DnAJ-like protein slr0093 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0093 PE=3 SV=1 14 83 5.0E-10
sp|Q24133|DNAJ1_DROME DnaJ protein homolog 1 OS=Drosophila melanogaster GN=DnaJ-1 PE=1 SV=3 12 87 6.0E-10
sp|B9IY80|DNAJ_BACCQ Chaperone protein DnaJ OS=Bacillus cereus (strain Q1) GN=dnaJ PE=3 SV=1 14 86 6.0E-10
sp|B7HPL2|DNAJ_BACC7 Chaperone protein DnaJ OS=Bacillus cereus (strain AH187) GN=dnaJ PE=3 SV=1 14 86 6.0E-10
sp|Q730M2|DNAJ_BACC1 Chaperone protein DnaJ OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dnaJ PE=3 SV=1 14 86 6.0E-10
sp|Q8WWF6|DNJB3_HUMAN DnaJ homolog subfamily B member 3 OS=Homo sapiens GN=DNAJB3 PE=1 SV=1 14 86 6.0E-10
sp|Q182E7|DNAJ_PEPD6 Chaperone protein DnaJ OS=Peptoclostridium difficile (strain 630) GN=dnaJ PE=3 SV=1 14 87 6.0E-10
sp|O94625|SPJ1_SCHPO DnaJ-related protein spj1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spj1 PE=2 SV=2 18 87 6.0E-10
sp|Q9QYJ3|DNJB1_MOUSE DnaJ homolog subfamily B member 1 OS=Mus musculus GN=Dnajb1 PE=1 SV=3 12 84 7.0E-10
sp|P25685|DNJB1_HUMAN DnaJ homolog subfamily B member 1 OS=Homo sapiens GN=DNAJB1 PE=1 SV=4 12 84 8.0E-10
sp|F1RTY8|DNJ5B_PIG DnaJ homolog subfamily C member 5B OS=Sus scrofa GN=DNAJC5B PE=3 SV=1 16 87 9.0E-10
sp|Q2KIJ8|DNJ5B_BOVIN DnaJ homolog subfamily C member 5B OS=Bos taurus GN=DNAJC5B PE=2 SV=1 16 87 9.0E-10
sp|Q5FWN8|DNJ6A_XENLA DnaJ homolog subfamily B member 6-A OS=Xenopus laevis GN=dnajb6-a PE=2 SV=1 17 87 9.0E-10
sp|Q9CQ94|DNJ5B_MOUSE DnaJ homolog subfamily C member 5B OS=Mus musculus GN=Dnajc5b PE=1 SV=1 16 87 1.0E-09
sp|Q9UXR9|DNAJ_METTE Chaperone protein DnaJ OS=Methanosarcina thermophila GN=dnaJ PE=3 SV=1 14 91 1.0E-09
sp|Q6VAY5|DNAJ_PSEST Chaperone protein DnaJ OS=Pseudomonas stutzeri GN=dnaJ PE=3 SV=1 16 87 1.0E-09
sp|Q1QSX1|DNAJ_CHRSD Chaperone protein DnaJ OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=dnaJ PE=3 SV=1 14 87 1.0E-09
sp|A5CX57|DNAJ_VESOH Chaperone protein DnaJ OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=dnaJ PE=3 SV=1 16 87 1.0E-09
sp|A1TLH8|DNAJ_ACIAC Chaperone protein DnaJ OS=Acidovorax citrulli (strain AAC00-1) GN=dnaJ PE=3 SV=1 16 87 1.0E-09
sp|D3ZD82|DNJ5B_RAT DnaJ homolog subfamily C member 5B OS=Rattus norvegicus GN=Dnajc5b PE=1 SV=1 16 87 1.0E-09
sp|Q818F0|DNAJ_BACCR Chaperone protein DnaJ OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dnaJ PE=3 SV=1 14 86 1.0E-09
sp|D2H417|DNJ5B_AILME DnaJ homolog subfamily C member 5B OS=Ailuropoda melanoleuca GN=DNAJC5B PE=3 SV=1 16 87 1.0E-09
sp|B7HCT9|DNAJ_BACC4 Chaperone protein DnaJ OS=Bacillus cereus (strain B4264) GN=dnaJ PE=3 SV=1 14 86 1.0E-09
sp|B7IYG6|DNAJ_BACC2 Chaperone protein DnaJ OS=Bacillus cereus (strain G9842) GN=dnaJ PE=3 SV=1 14 86 1.0E-09
sp|P25686|DNJB2_HUMAN DnaJ homolog subfamily B member 2 OS=Homo sapiens GN=DNAJB2 PE=1 SV=3 17 87 1.0E-09
sp|P30725|DNAJ_CLOAB Chaperone protein DnaJ OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=dnaJ PE=2 SV=2 14 85 1.0E-09
sp|A4G8D1|DNAJ_HERAR Chaperone protein DnaJ OS=Herminiimonas arsenicoxydans GN=dnaJ PE=3 SV=1 16 87 1.0E-09
sp|B3R6G6|DNAJ_CUPTR Chaperone protein DnaJ OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=dnaJ PE=3 SV=1 14 87 1.0E-09
sp|P60905|DNJC5_RAT DnaJ homolog subfamily C member 5 OS=Rattus norvegicus GN=Dnajc5 PE=1 SV=1 16 87 1.0E-09
sp|P60904|DNJC5_MOUSE DnaJ homolog subfamily C member 5 OS=Mus musculus GN=Dnajc5 PE=1 SV=1 16 87 1.0E-09
sp|Q9H3Z4|DNJC5_HUMAN DnaJ homolog subfamily C member 5 OS=Homo sapiens GN=DNAJC5 PE=1 SV=1 16 87 2.0E-09
sp|Q5WV16|DNAJ_LEGPL Chaperone protein DnaJ OS=Legionella pneumophila (strain Lens) GN=dnaJ PE=3 SV=1 14 87 2.0E-09
sp|P50025|DNAJ_LEGPN Chaperone protein DnaJ OS=Legionella pneumophila GN=dnaJ PE=3 SV=1 14 87 2.0E-09
sp|Q5ZTY4|DNAJ_LEGPH Chaperone protein DnaJ OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=dnaJ PE=3 SV=1 14 87 2.0E-09
sp|A5IDK7|DNAJ_LEGPC Chaperone protein DnaJ OS=Legionella pneumophila (strain Corby) GN=dnaJ PE=3 SV=1 14 87 2.0E-09
sp|Q5X3M8|DNAJ_LEGPA Chaperone protein DnaJ OS=Legionella pneumophila (strain Paris) GN=dnaJ PE=3 SV=1 14 87 2.0E-09
sp|A4XYF5|DNAJ_PSEMY Chaperone protein DnaJ OS=Pseudomonas mendocina (strain ymp) GN=dnaJ PE=3 SV=1 14 87 2.0E-09
sp|Q29455|DNJC5_BOVIN DnaJ homolog subfamily C member 5 OS=Bos taurus GN=DNAJC5 PE=2 SV=1 16 87 2.0E-09
sp|A9VHU0|DNAJ_BACWK Chaperone protein DnaJ OS=Bacillus weihenstephanensis (strain KBAB4) GN=dnaJ PE=3 SV=1 14 86 2.0E-09
sp|A9BNG6|DNAJ_DELAS Chaperone protein DnaJ OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=dnaJ PE=3 SV=1 16 87 2.0E-09
sp|Q9UF47|DNJ5B_HUMAN DnaJ homolog subfamily C member 5B OS=Homo sapiens GN=DNAJC5B PE=1 SV=2 16 87 2.0E-09
sp|P48207|DNAJ_FRATU Chaperone protein DnaJ OS=Francisella tularensis GN=dnaJ PE=3 SV=1 17 87 2.0E-09
sp|Q2A327|DNAJ_FRATH Chaperone protein DnaJ OS=Francisella tularensis subsp. holarctica (strain LVS) GN=dnaJ PE=3 SV=1 17 87 2.0E-09
sp|Q6KHF9|DNAJ_MYCMO Chaperone protein DnaJ OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=dnaJ PE=3 SV=1 14 87 2.0E-09
sp|Q823T2|DNAJ_CHLCV Chaperone protein DnaJ OS=Chlamydophila caviae (strain GPIC) GN=dnaJ PE=3 SV=1 14 86 2.0E-09
sp|A6LJ63|DNAJ_THEM4 Chaperone protein DnaJ OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=dnaJ PE=3 SV=1 14 86 2.0E-09
sp|O35824|DNJA2_RAT DnaJ homolog subfamily A member 2 OS=Rattus norvegicus GN=Dnaja2 PE=1 SV=1 13 87 2.0E-09
sp|A4IX29|DNAJ_FRATW Chaperone protein DnaJ OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=dnaJ PE=3 SV=1 17 87 2.0E-09
sp|Q9QYJ0|DNJA2_MOUSE DnaJ homolog subfamily A member 2 OS=Mus musculus GN=Dnaja2 PE=1 SV=1 13 87 2.0E-09
sp|Q2HJ94|DNJA2_BOVIN DnaJ homolog subfamily A member 2 OS=Bos taurus GN=DNAJA2 PE=2 SV=1 13 87 2.0E-09
sp|O60884|DNJA2_HUMAN DnaJ homolog subfamily A member 2 OS=Homo sapiens GN=DNAJA2 PE=1 SV=1 13 87 2.0E-09
sp|B7IFE0|DNAJ_THEAB Chaperone protein DnaJ OS=Thermosipho africanus (strain TCF52B) GN=dnaJ PE=3 SV=1 14 86 3.0E-09
sp|Q5NFG8|DNAJ_FRATT Chaperone protein DnaJ OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=dnaJ PE=3 SV=1 17 87 3.0E-09
sp|Q14GX0|DNAJ_FRAT1 Chaperone protein DnaJ OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=dnaJ PE=3 SV=1 17 87 3.0E-09
sp|O34136|DNAJ_DEIPM Chaperone protein DnaJ OS=Deinococcus proteolyticus (strain ATCC 35074 / DSM 20540 / JCM 6276 / NBRC 101906 / NCIMB 13154 / VKM Ac-1939 / CCM 2703 / MRP) GN=dnaJ PE=3 SV=2 14 83 3.0E-09
sp|A1WAR7|DNAJ_ACISJ Chaperone protein DnaJ OS=Acidovorax sp. (strain JS42) GN=dnaJ PE=3 SV=1 16 87 3.0E-09
sp|Q601X8|DNAJ_MYCH2 Chaperone protein DnaJ OS=Mycoplasma hyopneumoniae (strain 232) GN=dnaJ PE=3 SV=2 16 87 3.0E-09
sp|C1DFM2|DNAJ_AZOVD Chaperone protein DnaJ OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=dnaJ PE=3 SV=1 14 87 3.0E-09
sp|Q8CXD3|DNAJ_OCEIH Chaperone protein DnaJ OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=dnaJ PE=3 SV=1 14 86 3.0E-09
sp|Q3AF07|DNAJ_CARHZ Chaperone protein DnaJ OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=dnaJ PE=3 SV=1 14 87 3.0E-09
sp|A6T225|DNAJ_JANMA Chaperone protein DnaJ OS=Janthinobacterium sp. (strain Marseille) GN=dnaJ PE=3 SV=1 16 87 3.0E-09
sp|A0KMI5|DNAJ_AERHH Chaperone protein DnaJ OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=dnaJ PE=3 SV=1 16 87 3.0E-09
sp|A7NS65|DNAJ_ROSCS Chaperone protein DnaJ OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=dnaJ PE=3 SV=1 14 86 3.0E-09
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 11 87 3.0E-09
sp|Q7MN84|DNAJ_VIBVY Chaperone protein DnaJ OS=Vibrio vulnificus (strain YJ016) GN=dnaJ PE=3 SV=2 16 87 4.0E-09
sp|Q8DF67|DNAJ_VIBVU Chaperone protein DnaJ OS=Vibrio vulnificus (strain CMCP6) GN=dnaJ PE=3 SV=1 16 87 4.0E-09
sp|A5UYW4|DNAJ_ROSS1 Chaperone protein DnaJ OS=Roseiflexus sp. (strain RS-1) GN=dnaJ PE=3 SV=1 14 86 4.0E-09
sp|A5N6M3|DNAJ_CLOK5 Chaperone protein DnaJ OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=dnaJ PE=3 SV=1 14 83 4.0E-09
sp|P25491|MAS5_YEAST Mitochondrial protein import protein MAS5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDJ1 PE=1 SV=1 16 88 4.0E-09
sp|Q55505|DNAJ1_SYNY3 Chaperone protein DnaJ 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dnaJ1 PE=3 SV=1 14 88 4.0E-09
sp|Q7NBW0|DNAJ_MYCGA Chaperone protein DnaJ OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=dnaJ PE=3 SV=2 14 87 4.0E-09
sp|B0CAZ0|DNAJ_ACAM1 Chaperone protein DnaJ OS=Acaryochloris marina (strain MBIC 11017) GN=dnaJ PE=3 SV=1 14 88 4.0E-09
sp|Q5L6F7|DNAJ_CHLAB Chaperone protein DnaJ OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=dnaJ PE=3 SV=1 14 83 4.0E-09
sp|Q74H58|DNAJ_GEOSL Chaperone protein DnaJ OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=dnaJ PE=3 SV=1 14 83 5.0E-09
sp|Q9Z9E9|DNAJ_CHLPN Chaperone protein DnaJ OS=Chlamydia pneumoniae GN=dnaJ PE=3 SV=1 14 83 5.0E-09
sp|B4F2V6|DNAJ_PROMH Chaperone protein DnaJ OS=Proteus mirabilis (strain HI4320) GN=dnaJ PE=3 SV=1 16 87 5.0E-09
sp|Q049W7|DNAJ_LACDB Chaperone protein DnaJ OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=dnaJ PE=3 SV=1 14 87 5.0E-09
sp|Q1G9R3|DNAJ_LACDA Chaperone protein DnaJ OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=dnaJ PE=3 SV=1 14 87 5.0E-09
sp|Q31HA6|DNAJ_THICR Chaperone protein DnaJ OS=Thiomicrospira crunogena (strain XCL-2) GN=dnaJ PE=3 SV=1 14 87 5.0E-09
sp|Q67S53|DNAJ_SYMTH Chaperone protein DnaJ OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=dnaJ PE=3 SV=1 14 85 5.0E-09
sp|P39102|XDJ1_YEAST DnaJ protein homolog XDJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=XDJ1 PE=1 SV=2 14 84 6.0E-09
sp|B8CXL0|DNAJ_HALOH Chaperone protein DnaJ OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=dnaJ PE=3 SV=1 14 87 6.0E-09
sp|B9MDJ8|DNAJ_ACIET Chaperone protein DnaJ OS=Acidovorax ebreus (strain TPSY) GN=dnaJ PE=3 SV=1 16 87 6.0E-09
sp|O42196|DNJC5_XENLA DnaJ homolog subfamily C member 5 OS=Xenopus laevis GN=dnajc5 PE=2 SV=1 16 87 6.0E-09
sp|B7KEJ8|DNAJ_CYAP7 Chaperone protein DnaJ OS=Cyanothece sp. (strain PCC 7424) GN=dnaJ PE=3 SV=1 14 88 6.0E-09
sp|B0SRF0|DNAJ_LEPBP Chaperone protein DnaJ OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=dnaJ PE=3 SV=1 13 82 6.0E-09
sp|B0SHT0|DNAJ_LEPBA Chaperone protein DnaJ OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=dnaJ PE=3 SV=1 13 82 6.0E-09
sp|Q8L397|DNAJ_ACHLA Chaperone protein DnaJ OS=Acholeplasma laidlawii GN=dnaJ PE=3 SV=1 14 88 7.0E-09
sp|A1WX30|DNAJ_HALHL Chaperone protein DnaJ OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=dnaJ PE=3 SV=1 14 87 7.0E-09
sp|A7GT07|DNAJ_BACCN Chaperone protein DnaJ OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dnaJ PE=3 SV=1 14 86 7.0E-09
sp|Q8DKR7|DNAJ_THEEB Chaperone protein DnaJ OS=Thermosynechococcus elongatus (strain BP-1) GN=dnaJ PE=3 SV=2 16 88 7.0E-09
sp|Q1LJ82|DNAJ_CUPMC Chaperone protein DnaJ OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=dnaJ PE=3 SV=1 14 87 7.0E-09
sp|Q6YPM2|DNAJ_ONYPE Chaperone protein DnaJ OS=Onion yellows phytoplasma (strain OY-M) GN=dnaJ PE=3 SV=1 14 85 7.0E-09
sp|A1JJD6|DNAJ_YERE8 Chaperone protein DnaJ OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=dnaJ PE=3 SV=1 14 87 7.0E-09
sp|Q15UD2|DNAJ_PSEA6 Chaperone protein DnaJ OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=dnaJ PE=3 SV=1 14 87 8.0E-09
sp|Q0A7E4|DNAJ_ALKEH Chaperone protein DnaJ OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=dnaJ PE=3 SV=1 14 87 8.0E-09
sp|Q8XIT1|DNAJ_CLOPE Chaperone protein DnaJ OS=Clostridium perfringens (strain 13 / Type A) GN=dnaJ PE=3 SV=1 14 85 8.0E-09
sp|Q5NSW9|DNAJ_BURM1 Chaperone protein DnaJ OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=dnaJ PE=3 SV=1 14 87 8.0E-09
sp|O87778|DNAJ_LACSK Chaperone protein DnaJ OS=Lactobacillus sakei GN=dnaJ PE=2 SV=1 14 87 9.0E-09
sp|Q38W94|DNAJ_LACSS Chaperone protein DnaJ OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=dnaJ PE=3 SV=1 14 87 9.0E-09
sp|B1Y787|DNAJ_LEPCP Chaperone protein DnaJ OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=dnaJ PE=3 SV=1 14 87 1.0E-08
sp|A7MWW1|DNAJ_VIBCB Chaperone protein DnaJ OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=dnaJ PE=3 SV=1 16 87 1.0E-08
sp|Q5F3Z5|DNJB6_CHICK DnaJ homolog subfamily B member 6 OS=Gallus gallus GN=DNAJB6 PE=2 SV=1 14 87 1.0E-08
sp|P25303|SCJ1_YEAST DnaJ-related protein SCJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCJ1 PE=1 SV=2 14 83 1.0E-08
sp|Q2SYZ3|DNAJ_BURTA Chaperone protein DnaJ OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=dnaJ PE=3 SV=1 14 87 1.0E-08
sp|A3DF24|DNAJ_CLOTH Chaperone protein DnaJ OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=dnaJ PE=3 SV=1 14 83 1.0E-08
sp|A8FYT9|DNAJ_SHESH Chaperone protein DnaJ OS=Shewanella sediminis (strain HAW-EB3) GN=dnaJ PE=3 SV=1 14 87 1.0E-08
sp|B0JW23|DNAJ_MICAN Chaperone protein DnaJ OS=Microcystis aeruginosa (strain NIES-843) GN=dnaJ PE=3 SV=1 14 88 1.0E-08
sp|Q46XI8|DNAJ_CUPPJ Chaperone protein DnaJ OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=dnaJ PE=3 SV=1 14 87 1.0E-08
sp|A2SIR5|DNAJ_METPP Chaperone protein DnaJ OS=Methylibium petroleiphilum (strain PM1) GN=dnaJ PE=3 SV=1 14 87 1.0E-08
sp|O33529|DNAJ_RHILE Chaperone protein DnaJ (Fragment) OS=Rhizobium leguminosarum GN=dnaJ PE=3 SV=1 16 87 1.0E-08
sp|P0CW06|DNAJ_METMZ Chaperone protein DnaJ OS=Methanosarcina mazei GN=dnaJ PE=3 SV=1 14 91 1.0E-08
sp|P0CW07|DNAJ_METMA Chaperone protein DnaJ OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=dnaJ PE=3 SV=1 14 91 1.0E-08
sp|Q63R47|DNAJ_BURPS Chaperone protein DnaJ OS=Burkholderia pseudomallei (strain K96243) GN=dnaJ PE=3 SV=1 14 87 1.0E-08
sp|Q3JP12|DNAJ_BURP1 Chaperone protein DnaJ OS=Burkholderia pseudomallei (strain 1710b) GN=dnaJ PE=3 SV=1 14 87 1.0E-08
sp|A3ND66|DNAJ_BURP6 Chaperone protein DnaJ OS=Burkholderia pseudomallei (strain 668) GN=dnaJ PE=3 SV=1 14 87 1.0E-08
sp|A3NYX5|DNAJ_BURP0 Chaperone protein DnaJ OS=Burkholderia pseudomallei (strain 1106a) GN=dnaJ PE=3 SV=1 14 87 1.0E-08
sp|A1V0U8|DNAJ_BURMS Chaperone protein DnaJ OS=Burkholderia mallei (strain SAVP1) GN=dnaJ PE=3 SV=1 14 87 1.0E-08
sp|Q62HD6|DNAJ_BURMA Chaperone protein DnaJ OS=Burkholderia mallei (strain ATCC 23344) GN=dnaJ PE=3 SV=1 14 87 1.0E-08
sp|A2S563|DNAJ_BURM9 Chaperone protein DnaJ OS=Burkholderia mallei (strain NCTC 10229) GN=dnaJ PE=3 SV=1 14 87 1.0E-08
sp|A3MN97|DNAJ_BURM7 Chaperone protein DnaJ OS=Burkholderia mallei (strain NCTC 10247) GN=dnaJ PE=3 SV=1 14 87 1.0E-08
sp|B4EDZ1|DNAJ_BURCJ Chaperone protein DnaJ OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=dnaJ PE=3 SV=1 14 87 2.0E-08
sp|A0K4S9|DNAJ_BURCH Chaperone protein DnaJ OS=Burkholderia cenocepacia (strain HI2424) GN=dnaJ PE=3 SV=1 14 87 2.0E-08
sp|B1JW20|DNAJ_BURCC Chaperone protein DnaJ OS=Burkholderia cenocepacia (strain MC0-3) GN=dnaJ PE=3 SV=1 14 87 2.0E-08
sp|Q1BYX2|DNAJ_BURCA Chaperone protein DnaJ OS=Burkholderia cenocepacia (strain AU 1054) GN=dnaJ PE=3 SV=1 14 87 2.0E-08
sp|A1BHL1|DNAJ_CHLPD Chaperone protein DnaJ OS=Chlorobium phaeobacteroides (strain DSM 266) GN=dnaJ PE=3 SV=1 14 88 2.0E-08
sp|B8DE39|DNAJ_LISMH Chaperone protein DnaJ OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dnaJ PE=3 SV=1 14 83 2.0E-08
sp|Q92BN9|DNAJ_LISIN Chaperone protein DnaJ OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dnaJ PE=3 SV=1 14 83 2.0E-08
sp|B1WVR2|DNAJ_CYAA5 Chaperone protein DnaJ OS=Cyanothece sp. (strain ATCC 51142) GN=dnaJ PE=3 SV=1 14 88 2.0E-08
sp|P0DJM1|DNAJ_LISMO Chaperone protein DnaJ OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dnaJ PE=3 SV=1 14 83 2.0E-08
sp|G2K045|DNAJ_LISM4 Chaperone protein DnaJ OS=Listeria monocytogenes serotype 1/2a (strain 10403S) GN=dnaJ PE=3 SV=1 14 83 2.0E-08
sp|Q0BI17|DNAJ_BURCM Chaperone protein DnaJ OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=dnaJ PE=3 SV=1 14 87 2.0E-08
sp|B1YTK1|DNAJ_BURA4 Chaperone protein DnaJ OS=Burkholderia ambifaria (strain MC40-6) GN=dnaJ PE=3 SV=1 14 87 2.0E-08
sp|P56101|DNJC5_TORCA DnaJ homolog subfamily C member 5 OS=Torpedo californica GN=dnajc5 PE=1 SV=1 14 87 2.0E-08
sp|B9E6X0|DNAJ_MACCJ Chaperone protein DnaJ OS=Macrococcus caseolyticus (strain JCSC5402) GN=dnaJ PE=3 SV=1 14 83 2.0E-08
sp|C3K274|DNAJ_PSEFS Chaperone protein DnaJ OS=Pseudomonas fluorescens (strain SBW25) GN=dnaJ PE=3 SV=1 14 87 2.0E-08
sp|Q8TQR1|DNAJ_METAC Chaperone protein DnaJ OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=dnaJ PE=3 SV=1 14 91 2.0E-08
sp|Q04960|DNJH_CUCSA DnaJ protein homolog OS=Cucumis sativus GN=DNAJ1 PE=2 SV=1 17 87 2.0E-08
sp|Q71ZJ8|DNAJ_LISMF Chaperone protein DnaJ OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dnaJ PE=3 SV=1 14 83 2.0E-08
sp|C1KVB9|DNAJ_LISMC Chaperone protein DnaJ OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dnaJ PE=3 SV=1 14 83 2.0E-08
sp|A8G9K9|DNAJ_SERP5 Chaperone protein DnaJ OS=Serratia proteamaculans (strain 568) GN=dnaJ PE=3 SV=1 14 87 2.0E-08
sp|Q9NXW2|DJB12_HUMAN DnaJ homolog subfamily B member 12 OS=Homo sapiens GN=DNAJB12 PE=1 SV=4 14 84 2.0E-08
sp|Q5RBD7|DJC22_PONAB DnaJ homolog subfamily C member 22 OS=Pongo abelii GN=DNAJC22 PE=2 SV=1 17 73 2.0E-08
sp|O54946|DNJB6_MOUSE DnaJ homolog subfamily B member 6 OS=Mus musculus GN=Dnajb6 PE=1 SV=4 14 87 2.0E-08
sp|B9DNJ9|DNAJ_STACT Chaperone protein DnaJ OS=Staphylococcus carnosus (strain TM300) GN=dnaJ PE=3 SV=1 14 83 2.0E-08
sp|Q7NXI1|DNAJ_CHRVO Chaperone protein DnaJ OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=dnaJ PE=3 SV=1 14 87 2.0E-08
sp|Q58DR2|DJB12_BOVIN DnaJ homolog subfamily B member 12 OS=Bos taurus GN=DNAJB12 PE=2 SV=1 14 84 2.0E-08
sp|B5YAR4|DNAJ_DICT6 Chaperone protein DnaJ OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=dnaJ PE=3 SV=1 14 86 2.0E-08
sp|Q9Y2G8|DJC16_HUMAN DnaJ homolog subfamily C member 16 OS=Homo sapiens GN=DNAJC16 PE=2 SV=3 17 86 2.0E-08
sp|Q5RCM7|DJC16_PONAB DnaJ homolog subfamily C member 16 OS=Pongo abelii GN=DNAJC16 PE=2 SV=1 17 86 2.0E-08
sp|Q5QXL2|DNAJ_IDILO Chaperone protein DnaJ OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=dnaJ PE=3 SV=1 16 83 2.0E-08
sp|Q8RH03|DNAJ_FUSNN Chaperone protein DnaJ OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=dnaJ PE=3 SV=1 14 87 2.0E-08
sp|A6WRU8|DNAJ_SHEB8 Chaperone protein DnaJ OS=Shewanella baltica (strain OS185) GN=dnaJ PE=3 SV=1 14 87 2.0E-08
sp|A3D7T3|DNAJ_SHEB5 Chaperone protein DnaJ OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=dnaJ PE=3 SV=1 14 87 2.0E-08
sp|B8E4S2|DNAJ_SHEB2 Chaperone protein DnaJ OS=Shewanella baltica (strain OS223) GN=dnaJ PE=3 SV=1 14 87 2.0E-08
sp|Q70WY6|DNAJ_FUSNP Chaperone protein DnaJ OS=Fusobacterium nucleatum subsp. polymorphum GN=dnaJ PE=3 SV=1 14 87 2.0E-08
sp|A9L0R7|DNAJ_SHEB9 Chaperone protein DnaJ OS=Shewanella baltica (strain OS195) GN=dnaJ PE=3 SV=1 14 87 2.0E-08
sp|Q54PV9|DJC11_DICDI DnaJ homolog subfamily C member 11 homolog OS=Dictyostelium discoideum GN=dnajc11 PE=3 SV=1 16 113 3.0E-08
sp|Q6LUA6|DNAJ_PHOPR Chaperone protein DnaJ OS=Photobacterium profundum GN=dnaJ PE=3 SV=1 16 85 3.0E-08
sp|Q45552|DNAJ_GEOSE Chaperone protein DnaJ OS=Geobacillus stearothermophilus GN=dnaJ PE=3 SV=1 14 85 3.0E-08
sp|Q87RX2|DNAJ_VIBPA Chaperone protein DnaJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=dnaJ PE=3 SV=1 16 87 3.0E-08
sp|Q6AYU3|DNJB6_RAT DnaJ homolog subfamily B member 6 OS=Rattus norvegicus GN=Dnajb6 PE=1 SV=1 14 87 3.0E-08
sp|O87385|DNAJ_VIBHA Chaperone protein DnaJ OS=Vibrio harveyi GN=dnaJ PE=3 SV=1 16 87 3.0E-08
sp|Q93R26|DNAJ_TETHA Chaperone protein DnaJ OS=Tetragenococcus halophilus GN=dnaJ PE=3 SV=1 14 83 3.0E-08
sp|B1LCI2|DNAJ_THESQ Chaperone protein DnaJ OS=Thermotoga sp. (strain RQ2) GN=dnaJ PE=3 SV=1 9 94 3.0E-08
sp|Q39JC7|DNAJ_BURL3 Chaperone protein DnaJ OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=dnaJ PE=3 SV=1 14 87 3.0E-08
sp|Q09912|PSI1_SCHPO Protein psi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psi1 PE=2 SV=2 13 83 3.0E-08
sp|Q114R3|DNAJ_TRIEI Chaperone protein DnaJ OS=Trichodesmium erythraeum (strain IMS101) GN=dnaJ PE=3 SV=1 14 88 3.0E-08
sp|Q9WZV3|DNAJ_THEMA Chaperone protein DnaJ OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=dnaJ PE=3 SV=1 9 94 3.0E-08
sp|Q8MPX3|DNJ20_CAEEL DnaJ homolog dnj-20 OS=Caenorhabditis elegans GN=dnj-20 PE=3 SV=2 1 88 3.0E-08
sp|A4JBS2|DNAJ_BURVG Chaperone protein DnaJ OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=dnaJ PE=3 SV=1 14 87 3.0E-08
sp|A0KTS6|DNAJ_SHESA Chaperone protein DnaJ OS=Shewanella sp. (strain ANA-3) GN=dnaJ PE=3 SV=1 14 87 3.0E-08
sp|Q9ZFC5|DNAJ_METSS Chaperone protein DnaJ OS=Methylovorus sp. (strain SS1 / DSM 11726) GN=dnaJ PE=3 SV=1 14 87 3.0E-08
sp|A6Q486|DNAJ_NITSB Chaperone protein DnaJ OS=Nitratiruptor sp. (strain SB155-2) GN=dnaJ PE=3 SV=1 14 105 3.0E-08
sp|Q0HY10|DNAJ_SHESR Chaperone protein DnaJ OS=Shewanella sp. (strain MR-7) GN=dnaJ PE=3 SV=1 14 87 3.0E-08
sp|Q0HLM9|DNAJ_SHESM Chaperone protein DnaJ OS=Shewanella sp. (strain MR-4) GN=dnaJ PE=3 SV=1 14 87 3.0E-08
sp|Q87WP1|DNAJ_PSESM Chaperone protein DnaJ OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=dnaJ PE=3 SV=1 14 87 3.0E-08
sp|O66921|DNAJ2_AQUAE Chaperone protein DnaJ 2 OS=Aquifex aeolicus (strain VF5) GN=dnaJ2 PE=3 SV=1 14 103 3.0E-08
sp|Q7NDG8|DNAJ_GLOVI Chaperone protein DnaJ OS=Gloeobacter violaceus (strain PCC 7421) GN=dnaJ PE=3 SV=1 16 85 3.0E-08
sp|Q03751|DNJC5_DROME DnaJ homolog subfamily C member 5 homolog OS=Drosophila melanogaster GN=Csp PE=1 SV=1 14 87 3.0E-08
sp|Q8EHT6|DNAJ_SHEON Chaperone protein DnaJ OS=Shewanella oneidensis (strain MR-1) GN=dnaJ PE=3 SV=1 14 87 3.0E-08
sp|Q5E3A8|DNAJ_VIBF1 Chaperone protein DnaJ OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=dnaJ PE=3 SV=1 16 87 4.0E-08
sp|A5IIT4|DNAJ_THEP1 Chaperone protein DnaJ OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=dnaJ PE=3 SV=1 9 94 4.0E-08
sp|B8F7S3|DNAJ_HAEPS Chaperone protein DnaJ OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=dnaJ PE=3 SV=1 14 83 4.0E-08
sp|B9MJZ0|DNAJ_CALBD Chaperone protein DnaJ OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=dnaJ PE=3 SV=1 14 91 4.0E-08
sp|Q97BG9|DNAJ_THEVO Chaperone protein DnaJ OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=dnaJ PE=3 SV=1 14 103 4.0E-08
sp|P43735|DNAJ_HAEIN Chaperone protein DnaJ OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dnaJ PE=3 SV=1 14 85 4.0E-08
sp|Q7M9T3|DNAJ_WOLSU Chaperone protein DnaJ OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=dnaJ PE=3 SV=1 14 110 4.0E-08
sp|Q607A6|DNAJ_METCA Chaperone protein DnaJ OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=dnaJ PE=3 SV=1 13 87 4.0E-08
sp|Q7VQL3|DNAJ_BLOFL Chaperone protein DnaJ OS=Blochmannia floridanus GN=dnaJ PE=3 SV=1 14 85 4.0E-08
sp|A1AW21|DNAJ_RUTMC Chaperone protein DnaJ OS=Ruthia magnifica subsp. Calyptogena magnifica GN=dnaJ PE=3 SV=1 14 86 4.0E-08
sp|B1KRT1|DNAJ_SHEWM Chaperone protein DnaJ OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=dnaJ PE=3 SV=1 14 87 4.0E-08
sp|Q47XI7|DNAJ_COLP3 Chaperone protein DnaJ OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=dnaJ PE=3 SV=1 14 87 4.0E-08
sp|A3QGW1|DNAJ_SHELP Chaperone protein DnaJ OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=dnaJ PE=3 SV=1 14 87 4.0E-08
sp|Q8XW41|DNAJ_RALSO Chaperone protein DnaJ OS=Ralstonia solanacearum (strain GMI1000) GN=dnaJ PE=3 SV=1 14 87 4.0E-08
sp|C8V213|MDJ1_EMENI DnaJ homolog 1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10778 PE=3 SV=1 17 85 5.0E-08
sp|P50018|DNAJ_AGRFC Chaperone protein DnaJ OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=dnaJ PE=2 SV=2 16 87 5.0E-08
sp|Q128K1|DNAJ_POLSJ Chaperone protein DnaJ OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=dnaJ PE=3 SV=1 14 87 5.0E-08
sp|Q72GN6|DNAJ_THET2 Chaperone protein DnaJ OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=dnaJ PE=3 SV=1 14 115 5.0E-08
sp|Q9KWS6|DNAJ_GEOTM Chaperone protein DnaJ OS=Geobacillus thermoglucosidasius GN=dnaJ PE=3 SV=1 14 85 5.0E-08
sp|Q5SLW9|DNAJ1_THET8 Chaperone protein DnaJ 1 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=dnaJ1 PE=3 SV=1 14 115 5.0E-08
sp|Q8RB67|DNAJ_CALS4 Chaperone protein DnaJ OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=dnaJ PE=3 SV=1 16 87 5.0E-08
sp|Q4ZNP8|DNAJ_PSEU2 Chaperone protein DnaJ OS=Pseudomonas syringae pv. syringae (strain B728a) GN=dnaJ PE=3 SV=1 14 87 5.0E-08
sp|C5D4U0|DNAJ_GEOSW Chaperone protein DnaJ OS=Geobacillus sp. (strain WCH70) GN=dnaJ PE=3 SV=1 14 85 5.0E-08
sp|Q48E63|DNAJ_PSE14 Chaperone protein DnaJ OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=dnaJ PE=3 SV=1 14 87 5.0E-08
sp|Q05646|DNAJ_ERYRH Chaperone protein DnaJ OS=Erysipelothrix rhusiopathiae GN=dnaJ PE=2 SV=1 16 85 5.0E-08
sp|O27352|DNAJ_METTH Chaperone protein DnaJ OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=dnaJ PE=3 SV=1 14 87 5.0E-08
sp|Q661A4|DNAJ_BORBP Chaperone protein DnaJ OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=dnaJ PE=3 SV=1 14 83 6.0E-08
sp|B9KAB9|DNAJ_THENN Chaperone protein DnaJ OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=dnaJ PE=3 SV=1 9 86 6.0E-08
sp|P53940|APJ1_YEAST J domain-containing protein APJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APJ1 PE=1 SV=1 16 83 6.0E-08
sp|B3EE31|DNAJ_CHLL2 Chaperone protein DnaJ OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=dnaJ PE=3 SV=1 14 83 6.0E-08
sp|A0AIS3|DNAJ_LISW6 Chaperone protein DnaJ OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dnaJ PE=3 SV=1 14 83 6.0E-08
sp|A1U613|DNAJ_MARHV Chaperone protein DnaJ OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=dnaJ PE=3 SV=1 14 87 6.0E-08
sp|Q9QYI7|DNJB8_MOUSE DnaJ homolog subfamily B member 8 OS=Mus musculus GN=Dnajb8 PE=2 SV=1 17 83 6.0E-08
sp|B6IVA5|DNAJ_RHOCS Chaperone protein DnaJ OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=dnaJ PE=3 SV=1 14 87 6.0E-08
sp|B2UBP2|DNAJ_RALPJ Chaperone protein DnaJ OS=Ralstonia pickettii (strain 12J) GN=dnaJ PE=3 SV=1 14 87 6.0E-08
sp|Q8L3D3|DNAJ_COLMA Chaperone protein DnaJ OS=Colwellia maris GN=dnaJ PE=3 SV=2 14 87 6.0E-08
sp|P59910|DJB13_HUMAN DnaJ homolog subfamily B member 13 OS=Homo sapiens GN=DNAJB13 PE=2 SV=1 12 99 7.0E-08
sp|Q253T6|DNAJ_CHLFF Chaperone protein DnaJ OS=Chlamydophila felis (strain Fe/C-56) GN=dnaJ PE=3 SV=1 14 83 7.0E-08
sp|B8GNX2|DNAJ_THISH Chaperone protein DnaJ OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=dnaJ PE=3 SV=1 14 87 7.0E-08
sp|P47265|DNAJ_MYCGE Chaperone protein DnaJ OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=dnaJ PE=3 SV=1 14 87 7.0E-08
sp|A5UF67|DNAJ_HAEIG Chaperone protein DnaJ OS=Haemophilus influenzae (strain PittGG) GN=dnaJ PE=3 SV=1 14 85 7.0E-08
sp|Q2YT48|DNAJ_STAAB Chaperone protein DnaJ OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dnaJ PE=3 SV=1 14 83 7.0E-08
sp|Q3SIN3|DNAJ_THIDA Chaperone protein DnaJ OS=Thiobacillus denitrificans (strain ATCC 25259) GN=dnaJ PE=3 SV=1 14 87 7.0E-08
sp|B0BTI6|DNAJ_ACTPJ Chaperone protein DnaJ OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=dnaJ PE=3 SV=1 14 87 7.0E-08
sp|Q6GGC1|DNAJ_STAAR Chaperone protein DnaJ OS=Staphylococcus aureus (strain MRSA252) GN=dnaJ PE=3 SV=1 14 83 7.0E-08
sp|P63972|DNAJ_STAAW Chaperone protein DnaJ OS=Staphylococcus aureus (strain MW2) GN=dnaJ PE=3 SV=1 14 83 7.0E-08
sp|A8Z4B8|DNAJ_STAAT Chaperone protein DnaJ OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dnaJ PE=3 SV=1 14 83 7.0E-08
sp|Q6G8Y8|DNAJ_STAAS Chaperone protein DnaJ OS=Staphylococcus aureus (strain MSSA476) GN=dnaJ PE=3 SV=1 14 83 7.0E-08
sp|P63971|DNAJ_STAAN Chaperone protein DnaJ OS=Staphylococcus aureus (strain N315) GN=dnaJ PE=1 SV=1 14 83 7.0E-08
sp|P63970|DNAJ_STAAM Chaperone protein DnaJ OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dnaJ PE=3 SV=1 14 83 7.0E-08
sp|A6QHC2|DNAJ_STAAE Chaperone protein DnaJ OS=Staphylococcus aureus (strain Newman) GN=dnaJ PE=3 SV=1 14 83 7.0E-08
sp|Q5HFI1|DNAJ_STAAC Chaperone protein DnaJ OS=Staphylococcus aureus (strain COL) GN=dnaJ PE=3 SV=1 14 83 7.0E-08
sp|A5ITA7|DNAJ_STAA9 Chaperone protein DnaJ OS=Staphylococcus aureus (strain JH9) GN=dnaJ PE=3 SV=1 14 83 7.0E-08
sp|Q2FXZ3|DNAJ_STAA8 Chaperone protein DnaJ OS=Staphylococcus aureus (strain NCTC 8325) GN=dnaJ PE=3 SV=1 14 83 7.0E-08
sp|Q2FGE4|DNAJ_STAA3 Chaperone protein DnaJ OS=Staphylococcus aureus (strain USA300) GN=dnaJ PE=3 SV=1 14 83 7.0E-08
sp|A6U251|DNAJ_STAA2 Chaperone protein DnaJ OS=Staphylococcus aureus (strain JH1) GN=dnaJ PE=3 SV=1 14 83 7.0E-08
sp|A7X2Y0|DNAJ_STAA1 Chaperone protein DnaJ OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dnaJ PE=3 SV=1 14 83 7.0E-08
sp|B6EKA0|DNAJ_ALISL Chaperone protein DnaJ OS=Aliivibrio salmonicida (strain LFI1238) GN=dnaJ PE=3 SV=1 16 87 7.0E-08
sp|Q3J7D9|DNAJ_NITOC Chaperone protein DnaJ OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=dnaJ PE=3 SV=1 14 82 7.0E-08
sp|A3N3J9|DNAJ_ACTP2 Chaperone protein DnaJ OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=dnaJ PE=3 SV=1 14 87 8.0E-08
sp|Q8N4W6|DJC22_HUMAN DnaJ homolog subfamily C member 22 OS=Homo sapiens GN=DNAJC22 PE=2 SV=1 17 73 8.0E-08
sp|P28616|DNAJ_BORBU Chaperone protein DnaJ OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=dnaJ PE=2 SV=2 14 83 8.0E-08
sp|O52065|DNAJ_MANHA Chaperone protein DnaJ OS=Mannheimia haemolytica GN=dnaJ PE=3 SV=1 14 87 8.0E-08
sp|C1DD87|DNAJ_LARHH Chaperone protein DnaJ OS=Laribacter hongkongensis (strain HLHK9) GN=dnaJ PE=3 SV=1 16 87 8.0E-08
sp|B5BLH9|DNAJ_SALPK Chaperone protein DnaJ OS=Salmonella paratyphi A (strain AKU_12601) GN=dnaJ PE=3 SV=1 14 85 8.0E-08
sp|Q5PDJ4|DNAJ_SALPA Chaperone protein DnaJ OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=dnaJ PE=3 SV=3 14 85 8.0E-08
sp|P08622|DNAJ_ECOLI Chaperone protein DnaJ OS=Escherichia coli (strain K12) GN=dnaJ PE=1 SV=3 14 85 8.0E-08
sp|B1XBE0|DNAJ_ECODH Chaperone protein DnaJ OS=Escherichia coli (strain K12 / DH10B) GN=dnaJ PE=3 SV=1 14 85 8.0E-08
sp|P0A1G7|DNAJ_SALTY Chaperone protein DnaJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dnaJ PE=3 SV=2 14 85 8.0E-08
sp|P0A1G8|DNAJ_SALTI Chaperone protein DnaJ OS=Salmonella typhi GN=dnaJ PE=3 SV=2 14 85 8.0E-08
sp|B4TVZ6|DNAJ_SALSV Chaperone protein DnaJ OS=Salmonella schwarzengrund (strain CVM19633) GN=dnaJ PE=3 SV=1 14 85 8.0E-08
sp|C0Q4F4|DNAJ_SALPC Chaperone protein DnaJ OS=Salmonella paratyphi C (strain RKS4594) GN=dnaJ PE=3 SV=1 14 85 8.0E-08
sp|A9MXI3|DNAJ_SALPB Chaperone protein DnaJ OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=dnaJ PE=3 SV=1 14 85 8.0E-08
sp|B4T6D7|DNAJ_SALNS Chaperone protein DnaJ OS=Salmonella newport (strain SL254) GN=dnaJ PE=3 SV=1 14 85 8.0E-08
sp|B4TIB5|DNAJ_SALHS Chaperone protein DnaJ OS=Salmonella heidelberg (strain SL476) GN=dnaJ PE=3 SV=1 14 85 8.0E-08
sp|B5RF09|DNAJ_SALG2 Chaperone protein DnaJ OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=dnaJ PE=3 SV=1 14 85 8.0E-08
sp|B5R5I3|DNAJ_SALEP Chaperone protein DnaJ OS=Salmonella enteritidis PT4 (strain P125109) GN=dnaJ PE=3 SV=1 14 85 8.0E-08
sp|B5FHA7|DNAJ_SALDC Chaperone protein DnaJ OS=Salmonella dublin (strain CT_02021853) GN=dnaJ PE=3 SV=1 14 85 8.0E-08
sp|Q57TP2|DNAJ_SALCH Chaperone protein DnaJ OS=Salmonella choleraesuis (strain SC-B67) GN=dnaJ PE=3 SV=3 14 85 8.0E-08
sp|B5F6Y9|DNAJ_SALA4 Chaperone protein DnaJ OS=Salmonella agona (strain SL483) GN=dnaJ PE=3 SV=1 14 85 8.0E-08
sp|Q0T8H5|DNAJ_SHIF8 Chaperone protein DnaJ OS=Shigella flexneri serotype 5b (strain 8401) GN=dnaJ PE=3 SV=1 14 85 8.0E-08
sp|A6VCL7|DNAJ_PSEA7 Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain PA7) GN=dnaJ PE=3 SV=1 16 87 8.0E-08
sp|C4ZPU1|DNAJ_ECOBW Chaperone protein DnaJ OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=dnaJ PE=3 SV=1 14 85 8.0E-08
sp|O74752|MAS5_SCHPO Mitochondrial protein import protein mas5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mas5 PE=3 SV=1 16 84 8.0E-08
sp|Q6P642|DNJB6_XENTR DnaJ homolog subfamily B member 6 OS=Xenopus tropicalis GN=dnajb6 PE=2 SV=1 17 81 8.0E-08
sp|Q5P9E0|DNAJ_ANAMM Chaperone protein DnaJ OS=Anaplasma marginale (strain St. Maries) GN=dnaJ PE=3 SV=1 12 83 8.0E-08
sp|B9KH92|DNAJ_ANAMF Chaperone protein DnaJ OS=Anaplasma marginale (strain Florida) GN=dnaJ PE=3 SV=1 12 83 8.0E-08
sp|Q9HV44|DNAJ_PSEAE Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=dnaJ PE=3 SV=1 16 87 8.0E-08
sp|Q02FR2|DNAJ_PSEAB Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=dnaJ PE=3 SV=1 16 87 8.0E-08
sp|B7V1H2|DNAJ_PSEA8 Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain LESB58) GN=dnaJ PE=3 SV=1 16 87 8.0E-08
sp|Q326K6|DNAJ_SHIBS Chaperone protein DnaJ OS=Shigella boydii serotype 4 (strain Sb227) GN=dnaJ PE=3 SV=1 14 85 9.0E-08
sp|B2U233|DNAJ_SHIB3 Chaperone protein DnaJ OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=dnaJ PE=3 SV=1 14 85 9.0E-08
sp|Q3Z600|DNAJ_SHISS Chaperone protein DnaJ OS=Shigella sonnei (strain Ss046) GN=dnaJ PE=3 SV=1 14 85 9.0E-08
sp|B7LVP7|DNAJ_ESCF3 Chaperone protein DnaJ OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=dnaJ PE=3 SV=1 14 85 9.0E-08
sp|Q1RGI7|DNAJ_ECOUT Chaperone protein DnaJ OS=Escherichia coli (strain UTI89 / UPEC) GN=dnaJ PE=3 SV=1 14 85 9.0E-08
sp|B1LFU5|DNAJ_ECOSM Chaperone protein DnaJ OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=dnaJ PE=3 SV=1 14 85 9.0E-08
sp|B6HZ11|DNAJ_ECOSE Chaperone protein DnaJ OS=Escherichia coli (strain SE11) GN=dnaJ PE=3 SV=1 14 85 9.0E-08
sp|B7N7N9|DNAJ_ECOLU Chaperone protein DnaJ OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=dnaJ PE=3 SV=1 14 85 9.0E-08
sp|B1IRF9|DNAJ_ECOLC Chaperone protein DnaJ OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=dnaJ PE=3 SV=1 14 85 9.0E-08
sp|Q8FLC5|DNAJ_ECOL6 Chaperone protein DnaJ OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dnaJ PE=3 SV=3 14 85 9.0E-08
sp|A7ZVV8|DNAJ_ECOHS Chaperone protein DnaJ OS=Escherichia coli O9:H4 (strain HS) GN=dnaJ PE=3 SV=1 14 85 9.0E-08
sp|B7M0B1|DNAJ_ECO8A Chaperone protein DnaJ OS=Escherichia coli O8 (strain IAI1) GN=dnaJ PE=3 SV=1 14 85 9.0E-08
sp|B7MNM2|DNAJ_ECO81 Chaperone protein DnaJ OS=Escherichia coli O81 (strain ED1a) GN=dnaJ PE=3 SV=1 14 85 9.0E-08
sp|B7NHB7|DNAJ_ECO7I Chaperone protein DnaJ OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=dnaJ PE=3 SV=1 14 85 9.0E-08
sp|Q8XA65|DNAJ_ECO57 Chaperone protein DnaJ OS=Escherichia coli O157:H7 GN=dnaJ PE=3 SV=3 14 85 9.0E-08
sp|B7L4D9|DNAJ_ECO55 Chaperone protein DnaJ OS=Escherichia coli (strain 55989 / EAEC) GN=dnaJ PE=3 SV=1 14 85 9.0E-08
sp|B7MAD6|DNAJ_ECO45 Chaperone protein DnaJ OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=dnaJ PE=3 SV=1 14 85 9.0E-08
sp|B7UI60|DNAJ_ECO27 Chaperone protein DnaJ OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=dnaJ PE=3 SV=1 14 85 9.0E-08
sp|A7ZHA5|DNAJ_ECO24 Chaperone protein DnaJ OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=dnaJ PE=3 SV=1 14 85 9.0E-08
sp|Q9CMS2|DNAJ_PASMU Chaperone protein DnaJ OS=Pasteurella multocida (strain Pm70) GN=dnaJ PE=3 SV=1 14 87 9.0E-08
sp|Q32KA4|DNAJ_SHIDS Chaperone protein DnaJ OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=dnaJ PE=3 SV=1 14 85 9.0E-08
sp|Q4QJW5|DNAJ_HAEI8 Chaperone protein DnaJ OS=Haemophilus influenzae (strain 86-028NP) GN=dnaJ PE=3 SV=1 14 85 9.0E-08
sp|B5YYA8|DNAJ_ECO5E Chaperone protein DnaJ OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=dnaJ PE=3 SV=1 14 85 9.0E-08
sp|Q49Y21|DNAJ_STAS1 Chaperone protein DnaJ OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=dnaJ PE=3 SV=1 14 83 9.0E-08
sp|Q086J2|DNAJ_SHEFN Chaperone protein DnaJ OS=Shewanella frigidimarina (strain NCIMB 400) GN=dnaJ PE=3 SV=1 14 87 9.0E-08
sp|Q7UDU1|DNAJ_SHIFL Chaperone protein DnaJ OS=Shigella flexneri GN=dnaJ PE=3 SV=3 14 85 1.0E-07
sp|Q8YUA5|DNAJ_NOSS1 Chaperone protein DnaJ OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=dnaJ PE=3 SV=1 14 88 1.0E-07
sp|Q057X7|DNAJ_BUCCC Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=dnaJ PE=3 SV=1 14 87 1.0E-07
sp|Q8CP18|DNAJ_STAES Chaperone protein DnaJ OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dnaJ PE=3 SV=1 14 86 1.0E-07
sp|B0VA24|DNAJ_ACIBY Chaperone protein DnaJ OS=Acinetobacter baumannii (strain AYE) GN=dnaJ PE=3 SV=1 14 83 1.0E-07
sp|A3MA88|DNAJ_ACIBT Chaperone protein DnaJ OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=dnaJ PE=3 SV=2 14 83 1.0E-07
sp|B0VQ00|DNAJ_ACIBS Chaperone protein DnaJ OS=Acinetobacter baumannii (strain SDF) GN=dnaJ PE=3 SV=1 14 83 1.0E-07
sp|B2I2G6|DNAJ_ACIBC Chaperone protein DnaJ OS=Acinetobacter baumannii (strain ACICU) GN=dnaJ PE=3 SV=1 14 83 1.0E-07
sp|B7I2B2|DNAJ_ACIB5 Chaperone protein DnaJ OS=Acinetobacter baumannii (strain AB0057) GN=dnaJ PE=3 SV=1 14 83 1.0E-07
sp|B7GV08|DNAJ_ACIB3 Chaperone protein DnaJ OS=Acinetobacter baumannii (strain AB307-0294) GN=dnaJ PE=3 SV=1 14 83 1.0E-07
sp|Q1H3B9|DNAJ_METFK Chaperone protein DnaJ OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=dnaJ PE=3 SV=1 14 87 1.0E-07
sp|B5ZWQ1|DNAJ_RHILW Chaperone protein DnaJ OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=dnaJ PE=3 SV=1 16 87 1.0E-07
sp|A6T4F5|DNAJ_KLEP7 Chaperone protein DnaJ OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=dnaJ PE=3 SV=1 14 85 1.0E-07
sp|B5Y241|DNAJ_KLEP3 Chaperone protein DnaJ OS=Klebsiella pneumoniae (strain 342) GN=dnaJ PE=3 SV=1 14 85 1.0E-07
sp|Q7N8Y3|DNAJ_PHOLL Chaperone protein DnaJ OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=dnaJ PE=3 SV=1 14 87 1.0E-07
sp|Q3MG81|DNAJ_ANAVT Chaperone protein DnaJ OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=dnaJ PE=3 SV=1 14 88 1.0E-07
sp|Q493S6|DNAJ_BLOPB Chaperone protein DnaJ OS=Blochmannia pennsylvanicus (strain BPEN) GN=dnaJ PE=3 SV=1 14 87 1.0E-07
sp|B4S9D0|DNAJ_PROA2 Chaperone protein DnaJ OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=dnaJ PE=3 SV=1 14 88 1.0E-07
sp|A8FFD1|DNAJ_BACP2 Chaperone protein DnaJ OS=Bacillus pumilus (strain SAFR-032) GN=dnaJ PE=3 SV=1 14 83 1.0E-07
sp|Q6RSN5|DNAJ_RHIRD Chaperone protein DnaJ OS=Rhizobium radiobacter GN=dnaJ PE=1 SV=1 16 87 1.0E-07
sp|B9JGW2|DNAJ_AGRRK Chaperone protein DnaJ OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=dnaJ PE=3 SV=1 14 87 1.0E-07
sp|Q9QYI8|DNJB7_MOUSE DnaJ homolog subfamily B member 7 OS=Mus musculus GN=Dnajb7 PE=2 SV=2 14 87 1.0E-07
sp|Q5FVM7|DJC16_RAT DnaJ homolog subfamily C member 16 OS=Rattus norvegicus GN=Dnajc16 PE=2 SV=1 17 86 1.0E-07
sp|B2VGS0|DNAJ_ERWT9 Chaperone protein DnaJ OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=dnaJ PE=3 SV=1 14 87 1.0E-07
sp|Q93Q66|DNAJ_LACLC Chaperone protein DnaJ OS=Lactococcus lactis subsp. cremoris GN=dnaJ PE=3 SV=1 17 86 1.0E-07
sp|F4JIN3|DNJ29_ARATH DnaJ protein ERDJ2B OS=Arabidopsis thaliana GN=ERDJ2B PE=1 SV=1 17 83 1.0E-07
sp|Q7VEJ6|DNAJ_PROMA Chaperone protein DnaJ OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=dnaJ PE=3 SV=1 16 88 1.0E-07
sp|Q80TN4|DJC16_MOUSE DnaJ homolog subfamily C member 16 OS=Mus musculus GN=Dnajc16 PE=1 SV=2 17 86 1.0E-07
sp|Q5WHG0|DNAJ_BACSK Chaperone protein DnaJ OS=Bacillus clausii (strain KSM-K16) GN=dnaJ PE=3 SV=1 14 85 1.0E-07
sp|Q9QYI4|DJB12_MOUSE DnaJ homolog subfamily B member 12 OS=Mus musculus GN=Dnajb12 PE=1 SV=2 14 84 1.0E-07
sp|Q2KDW7|DNAJ_RHIEC Chaperone protein DnaJ OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=dnaJ PE=3 SV=1 16 87 1.0E-07
sp|Q0AIY0|DNAJ_NITEC Chaperone protein DnaJ OS=Nitrosomonas eutropha (strain C91) GN=dnaJ PE=3 SV=1 14 83 1.0E-07
sp|Q8WW22|DNJA4_HUMAN DnaJ homolog subfamily A member 4 OS=Homo sapiens GN=DNAJA4 PE=1 SV=1 17 87 1.0E-07
sp|Q6ME07|DNAJ_PARUW Chaperone protein DnaJ OS=Protochlamydia amoebophila (strain UWE25) GN=dnaJ PE=3 SV=1 14 87 1.0E-07
sp|A4XKA5|DNAJ_CALS8 Chaperone protein DnaJ OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=dnaJ PE=3 SV=1 14 87 1.0E-07
sp|Q862Z4|DNJB3_MACFU DnaJ homolog subfamily B member 3 OS=Macaca fuscata fuscata GN=DNAJB3 PE=2 SV=1 17 86 1.0E-07
sp|A7Z6W0|DNAJ_BACMF Chaperone protein DnaJ OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dnaJ PE=3 SV=1 14 83 1.0E-07
sp|B8CKF4|DNAJ_SHEPW Chaperone protein DnaJ OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=dnaJ PE=3 SV=1 16 87 2.0E-07
sp|A4Y9Q2|DNAJ_SHEPC Chaperone protein DnaJ OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=dnaJ PE=3 SV=1 14 87 2.0E-07
sp|Q5F5M1|DNAJ_NEIG1 Chaperone protein DnaJ OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=dnaJ PE=3 SV=1 16 83 2.0E-07
sp|A1RGN2|DNAJ_SHESW Chaperone protein DnaJ OS=Shewanella sp. (strain W3-18-1) GN=dnaJ PE=3 SV=1 14 87 2.0E-07
sp|Q9SR96|DNJ63_ARATH DnaJ protein ERDJ3A OS=Arabidopsis thaliana GN=ERDJ3A PE=1 SV=1 17 84 2.0E-07
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 16 87 2.0E-07
sp|Q1IF58|DNAJ_PSEE4 Chaperone protein DnaJ OS=Pseudomonas entomophila (strain L48) GN=dnaJ PE=3 SV=1 16 87 2.0E-07
sp|Q73XZ6|DNAJ1_MYCPA Chaperone protein DnaJ 1 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=dnaJ1 PE=3 SV=1 14 84 2.0E-07
sp|A8H759|DNAJ_SHEPA Chaperone protein DnaJ OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=dnaJ PE=3 SV=1 14 87 2.0E-07
sp|Q1MN12|DNAJ_RHIL3 Chaperone protein DnaJ OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=dnaJ PE=3 SV=1 16 87 2.0E-07
sp|B3PXH2|DNAJ_RHIE6 Chaperone protein DnaJ OS=Rhizobium etli (strain CIAT 652) GN=dnaJ PE=3 SV=1 16 87 2.0E-07
sp|Q5HNW7|DNAJ_STAEQ Chaperone protein DnaJ OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dnaJ PE=3 SV=1 14 86 2.0E-07
sp|Q03QU2|DNAJ_LACBA Chaperone protein DnaJ OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=dnaJ PE=3 SV=1 16 85 2.0E-07
sp|B9JZ89|DNAJ_AGRVS Chaperone protein DnaJ OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=dnaJ PE=3 SV=1 16 87 2.0E-07
sp|Q9LCQ4|DNAJ_BRECH Chaperone protein DnaJ OS=Brevibacillus choshinensis GN=dnaJ PE=3 SV=1 14 83 2.0E-07
sp|Q8KCD8|DNAJ_CHLTE Chaperone protein DnaJ OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=dnaJ PE=3 SV=1 14 83 2.0E-07
sp|Q54ED3|DNJA1_DICDI DnaJ homolog subfamily A member 1 homolog OS=Dictyostelium discoideum GN=dnaja1 PE=3 SV=1 17 87 2.0E-07
sp|Q4R7Y5|DNJB6_MACFA DnaJ homolog subfamily B member 6 OS=Macaca fascicularis GN=DNAJB6 PE=2 SV=1 14 81 2.0E-07
sp|Q9JMC3|DNJA4_MOUSE DnaJ homolog subfamily A member 4 OS=Mus musculus GN=Dnaja4 PE=1 SV=1 17 87 2.0E-07
sp|Q7Z6W7|DNJB7_HUMAN DnaJ homolog subfamily B member 7 OS=Homo sapiens GN=DNAJB7 PE=2 SV=2 14 87 2.0E-07
sp|A9MR76|DNAJ_SALAR Chaperone protein DnaJ OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=dnaJ PE=3 SV=1 14 85 2.0E-07
sp|O13633|YNF5_SCHPO Uncharacterized J domain-containing protein C17A3.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi041 PE=1 SV=1 17 83 2.0E-07
sp|Q12Q07|DNAJ_SHEDO Chaperone protein DnaJ OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=dnaJ PE=3 SV=1 14 87 2.0E-07
sp|Q8EUM4|DNAJ_MYCPE Chaperone protein DnaJ OS=Mycoplasma penetrans (strain HF-2) GN=dnaJ PE=3 SV=1 14 87 2.0E-07
sp|Q6F6R1|DNAJ_ACIAD Chaperone protein DnaJ OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=dnaJ PE=3 SV=1 14 83 2.0E-07
sp|B5ENA2|DNAJ_ACIF5 Chaperone protein DnaJ OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=dnaJ PE=3 SV=1 14 82 2.0E-07
sp|B7J7X8|DNAJ_ACIF2 Chaperone protein DnaJ OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=dnaJ PE=3 SV=1 14 82 2.0E-07
sp|Q65H55|DNAJ_BACLD Chaperone protein DnaJ OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dnaJ PE=3 SV=1 14 83 2.0E-07
sp|Q7WGI5|DNAJ_BORBR Chaperone protein DnaJ OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=dnaJ PE=3 SV=1 14 87 2.0E-07
sp|A7MIK3|DNAJ_CROS8 Chaperone protein DnaJ OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=dnaJ PE=3 SV=1 14 87 2.0E-07
sp|Q7W520|DNAJ_BORPA Chaperone protein DnaJ OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=dnaJ PE=3 SV=1 14 87 2.0E-07
sp|Q7VVY3|DNAJ_BORPE Chaperone protein DnaJ OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=dnaJ PE=3 SV=1 14 87 2.0E-07
sp|Q3B2T5|DNAJ_CHLL7 Chaperone protein DnaJ OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=dnaJ PE=3 SV=1 14 83 2.0E-07
sp|Q6L0S6|DNAJ_PICTO Chaperone protein DnaJ OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=dnaJ PE=3 SV=1 14 103 2.0E-07
sp|O94657|XDJ1_SCHPO DnaJ protein homolog xdj1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=xdj1 PE=3 SV=1 13 83 2.0E-07
sp|B2SXC7|DNAJ_BURPP Chaperone protein DnaJ OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=dnaJ PE=3 SV=1 14 87 2.0E-07
sp|Q5R8H0|DNJB6_PONAB DnaJ homolog subfamily B member 6 OS=Pongo abelii GN=DNAJB6 PE=2 SV=1 14 81 2.0E-07
sp|O75190|DNJB6_HUMAN DnaJ homolog subfamily B member 6 OS=Homo sapiens GN=DNAJB6 PE=1 SV=2 14 81 2.0E-07
sp|C4L8Y4|DNAJ_TOLAT Chaperone protein DnaJ OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=dnaJ PE=3 SV=1 14 87 2.0E-07
sp|A1VMG1|DNAJ_POLNA Chaperone protein DnaJ OS=Polaromonas naphthalenivorans (strain CJ2) GN=dnaJ PE=3 SV=1 14 87 2.0E-07
sp|B7VJX0|DNAJ_VIBTL Chaperone protein DnaJ OS=Vibrio tasmaniensis (strain LGP32) GN=dnaJ PE=3 SV=1 16 87 2.0E-07
sp|Q145F0|DNAJ_BURXL Chaperone protein DnaJ OS=Burkholderia xenovorans (strain LB400) GN=dnaJ PE=3 SV=1 14 87 2.0E-07
sp|P17631|DNAJ_BACSU Chaperone protein DnaJ OS=Bacillus subtilis (strain 168) GN=dnaJ PE=2 SV=3 14 83 3.0E-07
sp|O06431|DNAJ_NITEU Chaperone protein DnaJ OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=dnaJ PE=3 SV=2 14 83 3.0E-07
sp|B0TQC1|DNAJ_SHEHH Chaperone protein DnaJ OS=Shewanella halifaxensis (strain HAW-EB4) GN=dnaJ PE=3 SV=1 16 87 3.0E-07
sp|Q5KWZ8|DNAJ_GEOKA Chaperone protein DnaJ OS=Geobacillus kaustophilus (strain HTA426) GN=dnaJ PE=3 SV=1 14 85 3.0E-07
sp|A4W6D6|DNAJ_ENT38 Chaperone protein DnaJ OS=Enterobacter sp. (strain 638) GN=dnaJ PE=3 SV=1 16 85 3.0E-07
sp|P48208|DNAJ_HAEDU Chaperone protein DnaJ OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=dnaJ PE=3 SV=1 14 87 3.0E-07
sp|Q0III6|DNJB6_BOVIN DnaJ homolog subfamily B member 6 OS=Bos taurus GN=DNAJB6 PE=2 SV=1 14 81 3.0E-07
sp|Q4KIH0|DNAJ_PSEF5 Chaperone protein DnaJ OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=dnaJ PE=3 SV=1 14 87 3.0E-07
sp|O35723|DNJB3_MOUSE DnaJ homolog subfamily B member 3 OS=Mus musculus GN=Dnajb3 PE=2 SV=1 14 82 3.0E-07
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 13 87 3.0E-07
sp|B1JL03|DNAJ_YERPY Chaperone protein DnaJ OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=dnaJ PE=3 SV=1 14 87 3.0E-07
sp|Q66ES9|DNAJ_YERPS Chaperone protein DnaJ OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=dnaJ PE=3 SV=1 14 87 3.0E-07
sp|A4TQF8|DNAJ_YERPP Chaperone protein DnaJ OS=Yersinia pestis (strain Pestoides F) GN=dnaJ PE=3 SV=1 14 87 3.0E-07
sp|Q1CMV6|DNAJ_YERPN Chaperone protein DnaJ OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=dnaJ PE=3 SV=1 14 87 3.0E-07
sp|A9R014|DNAJ_YERPG Chaperone protein DnaJ OS=Yersinia pestis bv. Antiqua (strain Angola) GN=dnaJ PE=3 SV=1 14 87 3.0E-07
sp|Q8ZIM6|DNAJ_YERPE Chaperone protein DnaJ OS=Yersinia pestis GN=dnaJ PE=3 SV=1 14 87 3.0E-07
sp|B2K3M1|DNAJ_YERPB Chaperone protein DnaJ OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=dnaJ PE=3 SV=1 14 87 3.0E-07
sp|Q1C0J8|DNAJ_YERPA Chaperone protein DnaJ OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=dnaJ PE=3 SV=1 14 87 3.0E-07
sp|A1KR91|DNAJ_NEIMF Chaperone protein DnaJ OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=dnaJ PE=3 SV=1 16 83 3.0E-07
sp|P63969|DNAJ_NEIMB Chaperone protein DnaJ OS=Neisseria meningitidis serogroup B (strain MC58) GN=dnaJ PE=3 SV=1 16 83 3.0E-07
sp|P63968|DNAJ_NEIMA Chaperone protein DnaJ OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=dnaJ PE=3 SV=1 16 83 3.0E-07
sp|A9LZV9|DNAJ_NEIM0 Chaperone protein DnaJ OS=Neisseria meningitidis serogroup C (strain 053442) GN=dnaJ PE=3 SV=1 16 83 3.0E-07
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 13 87 3.0E-07
sp|Q2S030|DNAJ_SALRD Chaperone protein DnaJ OS=Salinibacter ruber (strain DSM 13855 / M31) GN=dnaJ PE=3 SV=1 14 87 3.0E-07
sp|Q04Y48|DNAJ_LEPBL Chaperone protein DnaJ OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=dnaJ PE=3 SV=1 17 82 3.0E-07
sp|Q04VC7|DNAJ_LEPBJ Chaperone protein DnaJ OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=dnaJ PE=3 SV=1 17 82 3.0E-07
sp|Q56237|DNAJ2_THET8 Chaperone protein DnaJ 2 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=dnaJ2 PE=3 SV=2 14 83 3.0E-07
sp|B0KIS4|DNAJ_PSEPG Chaperone protein DnaJ OS=Pseudomonas putida (strain GB-1) GN=dnaJ PE=3 SV=1 14 87 3.0E-07
sp|B1J255|DNAJ_PSEPW Chaperone protein DnaJ OS=Pseudomonas putida (strain W619) GN=dnaJ PE=3 SV=1 14 87 3.0E-07
sp|Q2SMM7|DNAJ_HAHCH Chaperone protein DnaJ OS=Hahella chejuensis (strain KCTC 2396) GN=dnaJ PE=3 SV=1 14 87 3.0E-07
sp|P61441|DNAJ_LEPIN Chaperone protein DnaJ OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=dnaJ PE=3 SV=1 17 82 3.0E-07
sp|P61440|DNAJ_LEPIC Chaperone protein DnaJ OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=dnaJ PE=3 SV=1 17 82 3.0E-07
sp|B3QPW8|DNAJ_CHLP8 Chaperone protein DnaJ OS=Chlorobaculum parvum (strain NCIB 8327) GN=dnaJ PE=3 SV=1 14 83 3.0E-07
sp|C5B7L8|DNAJ_EDWI9 Chaperone protein DnaJ OS=Edwardsiella ictaluri (strain 93-146) GN=dnaJ PE=3 SV=1 14 87 3.0E-07
sp|Q73Q15|DNAJ_TREDE Chaperone protein DnaJ OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=dnaJ PE=3 SV=2 14 85 4.0E-07
sp|A4SFR5|DNAJ_CHLPM Chaperone protein DnaJ OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=dnaJ PE=3 SV=1 14 83 4.0E-07
sp|Q82BY4|DNAJ2_STRAW Chaperone protein DnaJ 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=dnaJ2 PE=3 SV=1 14 84 4.0E-07
sp|B6IZJ1|DNAJ_COXB2 Chaperone protein DnaJ OS=Coxiella burnetii (strain CbuG_Q212) GN=dnaJ PE=3 SV=1 14 87 4.0E-07
sp|Q9PK53|DNAJ_CHLMU Chaperone protein DnaJ OS=Chlamydia muridarum (strain MoPn / Nigg) GN=dnaJ PE=3 SV=1 14 83 4.0E-07
sp|Q9RDD7|DNAJ2_STRCO Chaperone protein DnaJ 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=dnaJ2 PE=3 SV=1 14 84 4.0E-07
sp|O52164|DNAJ2_STRAL Chaperone protein DnaJ 2 OS=Streptomyces albus G GN=dnaJ2 PE=3 SV=1 14 84 4.0E-07
sp|Q3A8C3|DNAJ_PELCD Chaperone protein DnaJ OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=dnaJ PE=3 SV=1 14 81 4.0E-07
sp|A9IGC5|DNAJ_BORPD Chaperone protein DnaJ OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=dnaJ PE=3 SV=1 14 87 4.0E-07
sp|A9KG87|DNAJ_COXBN Chaperone protein DnaJ OS=Coxiella burnetii (strain Dugway 5J108-111) GN=dnaJ PE=3 SV=1 14 87 4.0E-07
sp|B6J7U6|DNAJ_COXB1 Chaperone protein DnaJ OS=Coxiella burnetii (strain CbuK_Q154) GN=dnaJ PE=3 SV=1 14 87 4.0E-07
sp|O84345|DNAJ_CHLTR Chaperone protein DnaJ OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=dnaJ PE=3 SV=1 14 83 4.0E-07
sp|B0BBX5|DNAJ_CHLTB Chaperone protein DnaJ OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=dnaJ PE=3 SV=1 14 83 4.0E-07
sp|Q3KM17|DNAJ_CHLTA Chaperone protein DnaJ OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=dnaJ PE=3 SV=1 14 83 4.0E-07
sp|B0B7R0|DNAJ_CHLT2 Chaperone protein DnaJ OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=dnaJ PE=3 SV=1 14 83 4.0E-07
sp|A1K4C4|DNAJ_AZOSB Chaperone protein DnaJ OS=Azoarcus sp. (strain BH72) GN=dnaJ PE=3 SV=1 14 87 4.0E-07
sp|Q74IT7|DNAJ_LACJO Chaperone protein DnaJ OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=dnaJ PE=3 SV=1 14 87 4.0E-07
sp|Q99M87|DNJA3_MOUSE DnaJ homolog subfamily A member 3, mitochondrial OS=Mus musculus GN=Dnaja3 PE=1 SV=1 13 87 4.0E-07
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 13 87 4.0E-07
sp|B2JGE1|DNAJ_BURP8 Chaperone protein DnaJ OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=dnaJ PE=3 SV=1 14 87 4.0E-07
sp|Q10209|YAY1_SCHPO Uncharacterized J domain-containing protein C4H3.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4H3.01 PE=1 SV=1 1 83 4.0E-07
sp|Q21H37|DNAJ_SACD2 Chaperone protein DnaJ OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=dnaJ PE=3 SV=1 14 87 5.0E-07
sp|Q8DWH2|DNAJ_STRMU Chaperone protein DnaJ OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dnaJ PE=3 SV=1 17 86 5.0E-07
sp|Q8A8C3|DNAJ_BACTN Chaperone protein DnaJ OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=dnaJ PE=3 SV=1 14 88 5.0E-07
sp|Q0I3V1|DNAJ_HAES1 Chaperone protein DnaJ OS=Haemophilus somnus (strain 129Pt) GN=dnaJ PE=3 SV=1 14 83 5.0E-07
sp|Q80Y75|DJB13_MOUSE DnaJ homolog subfamily B member 13 OS=Mus musculus GN=Dnajb13 PE=1 SV=1 12 99 5.0E-07
sp|B0UWR3|DNAJ_HISS2 Chaperone protein DnaJ OS=Histophilus somni (strain 2336) GN=dnaJ PE=3 SV=1 14 83 5.0E-07
sp|Q5P1H7|DNAJ2_AROAE Chaperone protein DnaJ 2 OS=Aromatoleum aromaticum (strain EbN1) GN=dnaJ2 PE=3 SV=1 14 87 5.0E-07
sp|Q96EY1|DNJA3_HUMAN DnaJ homolog subfamily A member 3, mitochondrial OS=Homo sapiens GN=DNAJA3 PE=1 SV=2 13 87 5.0E-07
sp|A1S8K6|DNAJ_SHEAM Chaperone protein DnaJ OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=dnaJ PE=3 SV=1 14 87 5.0E-07
sp|A4IR30|DNAJ_GEOTN Chaperone protein DnaJ OS=Geobacillus thermodenitrificans (strain NG80-2) GN=dnaJ PE=3 SV=1 14 85 5.0E-07
sp|B1ZGR2|DNAJ_METPB Chaperone protein DnaJ OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=dnaJ PE=3 SV=1 14 88 5.0E-07
sp|A9W6R8|DNAJ_METEP Chaperone protein DnaJ OS=Methylobacterium extorquens (strain PA1) GN=dnaJ PE=3 SV=1 14 88 5.0E-07
sp|B7KSZ5|DNAJ_METC4 Chaperone protein DnaJ OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=dnaJ PE=3 SV=1 14 88 5.0E-07
sp|P45555|DNAJ_STAAU Chaperone protein DnaJ OS=Staphylococcus aureus GN=dnaJ PE=3 SV=1 14 83 5.0E-07
sp|A5FZ18|DNAJ_ACICJ Chaperone protein DnaJ OS=Acidiphilium cryptum (strain JF-5) GN=dnaJ PE=3 SV=1 14 87 5.0E-07
sp|C0ZB49|DNAJ_BREBN Chaperone protein DnaJ OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=dnaJ PE=3 SV=1 16 83 5.0E-07
sp|A8EUC7|DNAJ_ARCB4 Chaperone protein DnaJ OS=Arcobacter butzleri (strain RM4018) GN=dnaJ PE=3 SV=1 14 87 6.0E-07
sp|A7FME2|DNAJ_YERP3 Chaperone protein DnaJ OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=dnaJ PE=3 SV=1 14 87 6.0E-07
sp|A1B4F0|DNAJ_PARDP Chaperone protein DnaJ OS=Paracoccus denitrificans (strain Pd 1222) GN=dnaJ PE=3 SV=1 14 85 6.0E-07
sp|B2RLJ0|DNAJ_PORG3 Chaperone protein DnaJ OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=dnaJ PE=3 SV=1 14 82 7.0E-07
sp|A5W9A2|DNAJ_PSEP1 Chaperone protein DnaJ OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=dnaJ PE=3 SV=1 14 87 7.0E-07
sp|Q88DU3|DNAJ_PSEPK Chaperone protein DnaJ OS=Pseudomonas putida (strain KT2440) GN=dnaJ PE=3 SV=1 14 87 7.0E-07
sp|A6VNB0|DNAJ_ACTSZ Chaperone protein DnaJ OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=dnaJ PE=3 SV=1 14 87 7.0E-07
sp|Q9XCA6|DNAJ_PORGI Chaperone protein DnaJ OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=dnaJ PE=3 SV=1 14 82 7.0E-07
sp|Q3K3T1|DNAJ_STRA1 Chaperone protein DnaJ OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dnaJ PE=3 SV=1 16 81 7.0E-07
sp|C4L424|DNAJ_EXISA Chaperone protein DnaJ OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=dnaJ PE=3 SV=1 14 86 7.0E-07
sp|Q5UXH9|DNAJ_HALMA Chaperone protein DnaJ OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=dnaJ PE=3 SV=1 16 83 8.0E-07
sp|A9KKT9|DNAJ_CLOPH Chaperone protein DnaJ OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=dnaJ PE=3 SV=1 14 87 9.0E-07
sp|Q64VI7|DNAJ_BACFR Chaperone protein DnaJ OS=Bacteroides fragilis (strain YCH46) GN=dnaJ PE=3 SV=1 14 88 9.0E-07
sp|Q5LED4|DNAJ_BACFN Chaperone protein DnaJ OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=dnaJ PE=3 SV=1 14 88 9.0E-07
sp|B2J3J3|DNAJ_NOSP7 Chaperone protein DnaJ OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=dnaJ PE=3 SV=1 14 88 9.0E-07
sp|A7I2G3|DNAJ_CAMHC Chaperone protein DnaJ OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=dnaJ PE=3 SV=1 14 87 9.0E-07
sp|Q9RUG2|DNAJ_DEIRA Chaperone protein DnaJ OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=dnaJ PE=3 SV=2 14 85 9.0E-07
sp|Q03FR6|DNAJ_PEDPA Chaperone protein DnaJ OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=dnaJ PE=3 SV=1 14 85 9.0E-07
sp|B1HUD0|DNAJ_LYSSC Chaperone protein DnaJ OS=Lysinibacillus sphaericus (strain C3-41) GN=dnaJ PE=3 SV=1 14 83 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

Domain # Start End Length
1 409 431 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|019260
MSSPVEATKEHGDDYLYHILNLSKGASQTEVHERYRTLSLVFHPDKQQDAQAKEVAARNFLEIQKAYQVLSDPFL
REVYDQLGDAGLALKWPETMRSKTIQEVRDHLSRMKGELLRHQQSAILLPKGTLECVVDATSLFQNAERHGSILG
RAASVRFNDYTLRHDVQKKINDKTTIRFGAQVKDRVHRLDISGTVRHQFSPRLSTSALLHFGFPFQVNLESSYQD
DSNSLVVKAFGALGAPLLFPPGLNIHSTRNLFKRRNKQASVNLHVGRHPHVYLRLTSITPFGLDAHSTRYTEEDF
ISASGSISGLELGTTFTSYGIDLEQRDPKLVAEGGVNLLELGTTLKTGFTMGIVGVKWFLSAVWLIPSTSSEIST
TTSIGPPGIFFVLQVTRLEQQITLPIYLSAEANVFLTLCTTVLPAVTGLLLYRFVVMPRRKAKKIAHLRAARKAL
EESDERRERNAVEGLLKDLARKHDQVEKSKQGLVIIQASYGGREKEEGAPDLTLDVTIPIQSLIRNSQLYIPSGE
EAKLNIQGFFDPAPLVSKVLRIRYLFREQMHYAEIPDYQPTVLPLLEHRVDGQ*
Coding >AgabiH97|019260
ATGAGCTCCCCTGTTGAAGCTACGAAGGAGCATGGGGATGATTACTTATATCACATCCTGAATCTCAGCAAAGGC
GCATCTCAGACCGAAGTACACGAACGATACCGCACTCTTTCTCTCGTATTTCATCCTGACAAGCAGCAAGACGCG
CAGGCAAAGGAAGTTGCTGCGCGAAATTTTCTTGAAATACAGAAGGCTTACCAAGTTTTGTCCGACCCTTTTCTC
CGCGAGGTGTATGACCAGCTAGGTGACGCGGGCCTGGCCTTGAAATGGCCGGAAACGATGCGTTCAAAAACGATA
CAAGAAGTGCGAGATCACTTGTCACGAATGAAAGGTGAACTTCTACGACATCAACAAAGCGCTATCCTCCTGCCC
AAAGGTACACTCGAGTGCGTCGTGGATGCCACATCATTGTTTCAAAATGCAGAACGGCATGGGTCAATTTTGGGC
CGCGCAGCTAGTGTCAGGTTCAATGATTACACGCTACGACACGATGTTCAGAAAAAAATAAATGACAAGACCACA
ATTCGTTTTGGAGCTCAAGTCAAGGATCGTGTGCATCGTCTTGACATAAGTGGGACAGTACGACACCAATTTTCT
CCCCGACTTTCGACATCAGCCCTTCTTCATTTCGGGTTCCCATTTCAAGTAAATCTAGAAAGCTCCTATCAAGAT
GACTCCAATTCCCTAGTCGTCAAAGCTTTTGGGGCTTTAGGCGCTCCATTACTTTTTCCTCCGGGATTGAATATC
CATTCAACTCGAAACTTGTTTAAGCGAAGAAATAAACAAGCTTCAGTTAACCTTCATGTTGGACGACACCCTCAT
GTGTATCTCCGCTTGACATCCATCACTCCTTTTGGCCTCGACGCTCACAGTACAAGATACACTGAAGAAGATTTC
ATATCAGCATCAGGATCGATATCCGGCTTGGAATTAGGGACCACCTTCACATCTTATGGCATAGACCTGGAGCAA
AGAGATCCTAAACTTGTGGCAGAGGGCGGCGTGAATTTGCTCGAGCTGGGGACGACACTTAAAACGGGATTCACG
ATGGGAATCGTGGGCGTGAAGTGGTTTTTATCTGCAGTCTGGTTAATTCCCTCGACTTCCAGCGAAATAAGTACC
ACTACATCGATAGGTCCTCCTGGCATATTCTTCGTGCTTCAGGTGACCCGCTTAGAACAACAGATTACGCTTCCC
ATTTATCTATCTGCAGAGGCCAATGTCTTCTTAACCCTCTGCACCACTGTGTTACCTGCTGTGACCGGCCTGTTG
CTGTATCGGTTTGTGGTTATGCCTCGCCGTAAGGCTAAAAAAATCGCGCATCTTCGTGCTGCTCGTAAGGCATTG
GAAGAATCAGATGAGCGACGAGAGAGAAACGCTGTGGAAGGCTTGTTGAAAGACCTCGCCCGAAAACACGATCAA
GTGGAGAAATCTAAACAAGGGTTGGTCATCATTCAAGCCAGCTACGGAGGTAGAGAAAAAGAAGAGGGTGCCCCC
GATCTGACGTTGGACGTCACAATACCGATCCAGTCCCTTATTCGGAACTCACAACTCTACATTCCCAGTGGCGAA
GAAGCTAAGCTGAACATCCAAGGATTTTTCGACCCTGCACCACTTGTATCCAAGGTCCTTCGCATCCGTTACCTC
TTTCGTGAACAAATGCACTACGCCGAAATTCCTGATTACCAACCTACCGTATTACCACTTCTAGAGCACCGGGTT
GATGGCCAATGA
Transcript >AgabiH97|019260
ATGAGCTCCCCTGTTGAAGCTACGAAGGAGCATGGGGATGATTACTTATATCACATCCTGAATCTCAGCAAAGGC
GCATCTCAGACCGAAGTACACGAACGATACCGCACTCTTTCTCTCGTATTTCATCCTGACAAGCAGCAAGACGCG
CAGGCAAAGGAAGTTGCTGCGCGAAATTTTCTTGAAATACAGAAGGCTTACCAAGTTTTGTCCGACCCTTTTCTC
CGCGAGGTGTATGACCAGCTAGGTGACGCGGGCCTGGCCTTGAAATGGCCGGAAACGATGCGTTCAAAAACGATA
CAAGAAGTGCGAGATCACTTGTCACGAATGAAAGGTGAACTTCTACGACATCAACAAAGCGCTATCCTCCTGCCC
AAAGGTACACTCGAGTGCGTCGTGGATGCCACATCATTGTTTCAAAATGCAGAACGGCATGGGTCAATTTTGGGC
CGCGCAGCTAGTGTCAGGTTCAATGATTACACGCTACGACACGATGTTCAGAAAAAAATAAATGACAAGACCACA
ATTCGTTTTGGAGCTCAAGTCAAGGATCGTGTGCATCGTCTTGACATAAGTGGGACAGTACGACACCAATTTTCT
CCCCGACTTTCGACATCAGCCCTTCTTCATTTCGGGTTCCCATTTCAAGTAAATCTAGAAAGCTCCTATCAAGAT
GACTCCAATTCCCTAGTCGTCAAAGCTTTTGGGGCTTTAGGCGCTCCATTACTTTTTCCTCCGGGATTGAATATC
CATTCAACTCGAAACTTGTTTAAGCGAAGAAATAAACAAGCTTCAGTTAACCTTCATGTTGGACGACACCCTCAT
GTGTATCTCCGCTTGACATCCATCACTCCTTTTGGCCTCGACGCTCACAGTACAAGATACACTGAAGAAGATTTC
ATATCAGCATCAGGATCGATATCCGGCTTGGAATTAGGGACCACCTTCACATCTTATGGCATAGACCTGGAGCAA
AGAGATCCTAAACTTGTGGCAGAGGGCGGCGTGAATTTGCTCGAGCTGGGGACGACACTTAAAACGGGATTCACG
ATGGGAATCGTGGGCGTGAAGTGGTTTTTATCTGCAGTCTGGTTAATTCCCTCGACTTCCAGCGAAATAAGTACC
ACTACATCGATAGGTCCTCCTGGCATATTCTTCGTGCTTCAGGTGACCCGCTTAGAACAACAGATTACGCTTCCC
ATTTATCTATCTGCAGAGGCCAATGTCTTCTTAACCCTCTGCACCACTGTGTTACCTGCTGTGACCGGCCTGTTG
CTGTATCGGTTTGTGGTTATGCCTCGCCGTAAGGCTAAAAAAATCGCGCATCTTCGTGCTGCTCGTAAGGCATTG
GAAGAATCAGATGAGCGACGAGAGAGAAACGCTGTGGAAGGCTTGTTGAAAGACCTCGCCCGAAAACACGATCAA
GTGGAGAAATCTAAACAAGGGTTGGTCATCATTCAAGCCAGCTACGGAGGTAGAGAAAAAGAAGAGGGTGCCCCC
GATCTGACGTTGGACGTCACAATACCGATCCAGTCCCTTATTCGGAACTCACAACTCTACATTCCCAGTGGCGAA
GAAGCTAAGCTGAACATCCAAGGATTTTTCGACCCTGCACCACTTGTATCCAAGGTCCTTCGCATCCGTTACCTC
TTTCGTGAACAAATGCACTACGCCGAAATTCCTGATTACCAACCTACCGTATTACCACTTCTAGAGCACCGGGTT
GATGGCCAATGA
Gene >AgabiH97|019260
ATGAGCTCCCCTGTTGAAGCTACGAAGGAGCATGGGGATGATTACTTATAGTCAGTTTCGTAGTCGTAACTTCAA
AAGTTTTACTTCTCACTTCTTTAACAGTCACATCCTGAATCTCAGCAAAGGCGCATCTCAGACCGAAGTACACGA
ACGATACCGCACTCTTTCTCTCGTATTTCATCCTGACAAGCAGCAAGACGCGCAGGCAAAGGAAGTTGCTGCGCG
AAATTTTCTTGAAATACAGAAGGCTTACCAAGGTTGCTTCCCGGTATCTGCTGTCTTAATGAGTGTAACGCTGAT
TGCTTGGGAACAGTTTTGTCCGACCCTTTTCTCCGGTATGCGCAATCTCCCCTCTGTATATGTAATTAAAGGGAG
TCTTATTTCAAACCAGCGAGGTGTATGACCAGCTAGGTATATTTTTCGTCACAGAAATCTTGAACATCTAACCCT
AACTTTTCCATTCAGGTGACGCGGGCCTGGCCTTGAAATGGCCGGAAACGATGCGTTCAAAAACGATACAAGAAG
TGCGCTACATCTCCTTCACTCAATCCATCCTGACTTTCGTCAGGTGCGAGATCACTTGTCACGAATGAAAGGTGA
ACTTCTACGACATCAACAAAGCGCTATCCTCCTGCCCAAAGGTACACTCGAGTGCGTCGTGGATGCCACATCATT
GTTTCAAAATGCAGAACGGCATGGGTCAATTTTGGGCCGCGCAGCTAGTGTCAGGTTCAATGATTACACGCTACG
ACACGATGTTCAGGTGGGGCCATACTTTCGAAAATTTCCCCAATTTGCTCACCTGAAGTAGAAAAAAATAAATGA
CAAGACCACAATTCGTTTTGGAGCTCAAGTCAAGGATCGTGTGCATCGTCTTGACATAAGTGGGACAGTACGACA
CCAATTTTCTCCCCGACTTTCGACATCAGTGAGTCGTTTGTACTTGGTAATCTTTGCTCTCAACTGATTTTAAAA
GGCCCTTCTTCATTTCGGGTTCCCATTTCAAGTAAATCTAGAAAGCTCCTATCAAGATGACTCCAATTCCCTAGT
CGTCAAAGCTTTTGGGGCTTTAGGCGCTCCATTACTTTTTCCTCCGGGATTGAATATCCATTCAACTCGAAACTT
GTTTAAGCGAAGAAATAAACAAGCTTCAGTTAACCTTCATGTTGGACGACACCCTCATGTGTATCTCCGCTTGAC
ATCCATCACTCCTTTTGGCCTCGACGCTCACAGTACAAGATACACTGAAGAAGATTTCATATCAGCATCAGGATC
GATATCCGGCTTGGAATTAGGGACCACCTTCACATCTTATGGCATAGACCTGGAGCAAAGAGATCCTAAACTTGT
GGCAGAGGGCGGCGTGAATTTGCTCGAGCTGGGGACGACACTTAAAACGGGATTCACGATGGGAATCGTGGGCGT
GAAGTGGTTTTTATCTGCAGTCTGGTTAATTCCCTCGACTTCCAGCGAAATAAGTACCACTACATCGATAGGTCC
TCCTGGCATATTCTTCGTGCTTCAGTAAGTAATTACACTGGGACCAACGGATATACTGATCAACTCGCTGCCAGG
GTGACCCGCTTAGAACAACAGATTACGCTTCCCATTTATCTATCTGCAGAGGCCAATGTCTTCTTAACCCTCTGC
ACCACTGTGTTACCTGCTGTGACCGGCCTGTTGCTGTATCGGTTTGTGGTTATGCCTCGCCGTAAGGCTAAAAAA
ATCGCGTGAGTGGTACATGTACACTTCTGATTTACTTGCTTACTTAATATGGTACTAGGCATCTTCGTGCTGCTC
GTAAGGCATTGGAAGAATCAGATGAGCGACGAGAGAGAAACGCTGTGGAAGGCTTGTTGAAAGACCTCGCCCGAA
AACACGATCAAGTGGAGAAATCTAAACAAGGTCCGAGACACTGCAGTTAAGATGCTTGGAAACTCATTATTTTCC
TAGGGTTGGTCATCATTCAAGCCAGCTACGGAGGTAGAGAAAAAGAAGAGGGTGCCCCCGATCTGACGTTGGACG
TCACAATACCGATCCAGTCCCTTATTCGGAACTCACAACTCTACATTCCCAGTGGCGAAGAAGCTAAGGTATTTA
TACATCCTTGTTTATCCGAAGCCAAAAGTTGATCTGGTGATAGCTGAACATCCAAGGATTTTTCGACCCTGCACC
ACTTGTATCCAAGGTCCTTCGCATCCGTTACCTCTTTCGTGAACAAATGCACTACGCCGAAATTCCTGATTACCA
ACCTACCGTATTACCACTTCTAGGTTAGTTCAGGGTTACTGTTGTCGAGCTGTTTCTGATTATCCGCAGAGCACC
GGGTTGATGGCCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail