Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|019200
Gene name
Locationscaffold_10:1119233..1124212
Strand-
Gene length (bp)4979
Transcript length (bp)3948
Coding sequence length (bp)3948
Protein length (aa) 1316

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00368 HMG-CoA_red Hydroxymethylglutaryl-coenzyme A reductase 1.3E-142 862 1241
PF12349 Sterol-sensing Sterol-sensing domain of SREBP cleavage-activation 1.6E-12 267 421

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|S0DQM8|HMDH_GIBF5 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) GN=HMGR PE=3 SV=1 218 1263 0.0E+00
sp|Q10283|HMDH_SCHPO 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hmg1 PE=1 SV=2 806 1254 0.0E+00
sp|P0CT44|HMDH_GIBFU 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Gibberella fujikuroi GN=HMGR PE=3 SV=1 658 1289 0.0E+00
sp|Q12649|HMDH_PHYB8 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=hmgA PE=3 SV=2 218 1260 0.0E+00
sp|P12684|HMDH2_YEAST 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HMG2 PE=1 SV=1 653 1257 3.0E-180
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|S0DQM8|HMDH_GIBF5 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) GN=HMGR PE=3 SV=1 218 1263 0.0E+00
sp|Q10283|HMDH_SCHPO 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hmg1 PE=1 SV=2 806 1254 0.0E+00
sp|P0CT44|HMDH_GIBFU 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Gibberella fujikuroi GN=HMGR PE=3 SV=1 658 1289 0.0E+00
sp|Q12649|HMDH_PHYB8 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=hmgA PE=3 SV=2 218 1260 0.0E+00
sp|P12684|HMDH2_YEAST 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HMG2 PE=1 SV=1 653 1257 3.0E-180
sp|Q01237|HMDH_MOUSE 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Mus musculus GN=Hmgcr PE=1 SV=3 767 1245 7.0E-174
sp|P12683|HMDH1_YEAST 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HMG1 PE=1 SV=1 806 1255 2.0E-173
sp|P00347|HMDH_CRIGR 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Cricetulus griseus GN=HMGCR PE=1 SV=1 767 1245 7.0E-173
sp|A7Z064|HMDH_BOVIN 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Bos taurus GN=HMGCR PE=2 SV=2 807 1245 1.0E-172
sp|O74164|HMDH_CYBJA 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Cyberlindnera jadinii GN=HMG PE=2 SV=1 807 1242 4.0E-172
sp|P09610|HMDH_MESAU 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Mesocricetus auratus GN=HMGCR PE=1 SV=1 807 1245 5.0E-172
sp|P51639|HMDH_RAT 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Rattus norvegicus GN=Hmgcr PE=1 SV=2 767 1245 1.0E-171
sp|P04035|HMDH_HUMAN 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Homo sapiens GN=HMGCR PE=1 SV=1 807 1245 5.0E-171
sp|Q5R6N3|HMDH_PONAB 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Pongo abelii GN=HMGCR PE=2 SV=1 807 1245 2.0E-170
sp|P34136|HMDH2_DICDI 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 OS=Dictyostelium discoideum GN=hmgB PE=2 SV=2 810 1248 5.0E-169
sp|Q29512|HMDH_RABIT 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Oryctolagus cuniculus GN=HMGCR PE=3 SV=1 807 1245 1.0E-168
sp|Q1W675|HMDH_PIG 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Sus scrofa GN=HMGCR PE=2 SV=1 807 1245 2.0E-168
sp|P54960|HMDH_BLAGE 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Blattella germanica PE=2 SV=1 807 1255 6.0E-168
sp|Q0C8L9|HMDH_ASPTN 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_09965 PE=3 SV=1 824 1242 1.0E-164
sp|Q9Y7D2|HMDH_ASPTE 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Aspergillus terreus PE=3 SV=2 824 1242 7.0E-164
sp|P20715|HMDH_XENLA 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Xenopus laevis GN=hmgcr PE=2 SV=1 807 1245 5.0E-163
sp|P34135|HMDH1_DICDI 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 OS=Dictyostelium discoideum GN=hmgA PE=2 SV=1 827 1245 1.0E-162
sp|P16393|HMDH_STRPU 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Strongylocentrotus purpuratus GN=HMGCR PE=2 SV=2 820 1265 8.0E-162
sp|Q9XHL5|HMDH3_ORYSJ 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3 OS=Oryza sativa subsp. japonica GN=HMG3 PE=2 SV=2 832 1245 5.0E-156
sp|Q03163|HMDH_CATRO 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Catharanthus roseus GN=HMGR PE=2 SV=1 820 1245 5.0E-156
sp|P29057|HMDH1_HEVBR 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 OS=Hevea brasiliensis GN=HMGR1 PE=2 SV=1 821 1245 5.0E-155
sp|P14891|HMDH1_ARATH 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 OS=Arabidopsis thaliana GN=HMG1 PE=1 SV=1 820 1245 1.0E-154
sp|Q01559|HMDH_NICSY 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Nicotiana sylvestris GN=HMGR PE=2 SV=1 820 1250 3.0E-153
sp|O64967|HMDH2_GOSHI 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 OS=Gossypium hirsutum GN=HMG2 PE=3 SV=1 820 1250 5.0E-153
sp|P48021|HMDH_CAMAC 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Camptotheca acuminata PE=3 SV=1 832 1250 7.0E-153
sp|O24594|HMDH_MAIZE 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Zea mays GN=HMGR PE=3 SV=1 831 1250 1.0E-152
sp|P48022|HMDH2_SOLLC 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 OS=Solanum lycopersicum GN=HMG2 PE=3 SV=1 791 1250 3.0E-152
sp|Q41438|HMDH3_SOLTU 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3 OS=Solanum tuberosum GN=HMG3 PE=2 SV=1 822 1242 1.0E-151
sp|O64966|HMDH1_GOSHI 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 OS=Gossypium hirsutum GN=HMG1 PE=3 SV=1 820 1241 1.0E-151
sp|P48020|HMDH1_SOLTU 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 OS=Solanum tuberosum GN=HMG1 PE=2 SV=1 831 1242 3.0E-151
sp|Q00583|HMDH3_HEVBR 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3 OS=Hevea brasiliensis GN=HMGR3 PE=2 SV=1 833 1245 2.0E-150
sp|Q9XEL8|HMDH2_CAPAN 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 OS=Capsicum annuum GN=HMGR2 PE=2 SV=1 772 1250 5.0E-150
sp|P43256|HMDH2_ARATH 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 OS=Arabidopsis thaliana GN=HMG2 PE=2 SV=1 822 1251 2.0E-149
sp|Q41437|HMDH2_SOLTU 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 OS=Solanum tuberosum GN=HMG2 PE=2 SV=1 791 1242 1.0E-147
sp|Q0DY59|HMDH1_ORYSJ 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 OS=Oryza sativa subsp. japonica GN=HMG1 PE=2 SV=2 824 1246 2.0E-146
sp|A2X8W3|HMDH1_ORYSI 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 OS=Oryza sativa subsp. indica GN=HMG1 PE=2 SV=2 827 1246 1.0E-145
sp|P14773|HMDH_DROME 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Drosophila melanogaster GN=Hmgcr PE=2 SV=2 765 1252 2.0E-143
sp|O76819|HMDH_AGRIP 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Agrotis ipsilon GN=HMGR PE=2 SV=1 791 1245 5.0E-141
sp|P16237|HMDH_SCHMA 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Schistosoma mansoni PE=2 SV=1 830 1254 6.0E-114
sp|O59469|HMDH_PYRHO 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=hmgA PE=3 SV=2 830 1236 2.0E-104
sp|Q9V1R3|HMDH_PYRAB 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=hmgA PE=3 SV=2 830 1236 3.0E-100
sp|O26662|HMDH_METTH 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hmgA PE=3 SV=1 841 1236 5.0E-96
sp|O08424|HMDH_SULSO 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=hmgA PE=1 SV=2 889 1242 6.0E-89
sp|Q59468|HMDH_HALVD 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=hmgA PE=1 SV=2 840 1241 4.0E-88
sp|Q58116|HMDH_METJA 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hmgA PE=3 SV=1 829 1241 5.0E-88
sp|Q9YAS4|HMDH_AERPE 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=hmgA PE=3 SV=1 824 1236 4.0E-85
sp|P29058|HMDH2_HEVBR 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 (Fragment) OS=Hevea brasiliensis GN=HMGR2 PE=2 SV=1 1042 1245 3.0E-83
sp|B0R6J9|HMDH_HALS3 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=hmgA PE=1 SV=1 899 1241 1.0E-77
sp|P0CT44|HMDH_GIBFU 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Gibberella fujikuroi GN=HMGR PE=3 SV=1 218 412 8.0E-32
sp|Q0C8L9|HMDH_ASPTN 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_09965 PE=3 SV=1 5 419 3.0E-25
sp|Q9Y7D2|HMDH_ASPTE 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Aspergillus terreus PE=3 SV=2 5 419 8.0E-22
sp|O74164|HMDH_CYBJA 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Cyberlindnera jadinii GN=HMG PE=2 SV=1 232 430 5.0E-19
sp|P12684|HMDH2_YEAST 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HMG2 PE=1 SV=1 225 417 2.0E-15
sp|Q10283|HMDH_SCHPO 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hmg1 PE=1 SV=2 194 416 3.0E-15
sp|P12683|HMDH1_YEAST 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HMG1 PE=1 SV=1 212 417 1.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0015936 coenzyme A metabolic process Yes
GO:0004420 hydroxymethylglutaryl-CoA reductase (NADPH) activity Yes
GO:0006793 phosphorus metabolic process No
GO:0009259 ribonucleotide metabolic process No
GO:0008152 metabolic process No
GO:0072521 purine-containing compound metabolic process No
GO:0044281 small molecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0033865 nucleoside bisphosphate metabolic process No
GO:0046483 heterocycle metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:1901360 organic cyclic compound metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0006163 purine nucleotide metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0044238 primary metabolic process No
GO:0034032 purine nucleoside bisphosphate metabolic process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0016491 oxidoreductase activity No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0019693 ribose phosphate metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0033875 ribonucleoside bisphosphate metabolic process No
GO:0003674 molecular_function No
GO:1901135 carbohydrate derivative metabolic process No
GO:0009117 nucleotide metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0009150 purine ribonucleotide metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 239 261 22
3 268 290 22
4 390 412 22
5 668 690 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|019200
MRFLLRPFALHAAYTPIETIVFFTIVGTLAYFHILNAIKHSAFLAPHNSPASLRPAHALFHAGEWVPVRESAWAS
AAADRRATSLELQQLIVSLDSQIIPESISLLDAPLSASAHNLTQHLTTTFASATNRKYPSICHRPFNTSLSTCFA
HQHSSSHSLVQTLAFVPGAPRDEWISALTANELGGRVFTDESGVEFQVESARTAADHVPIVRMKSPTWVAYAAGT
MVVRFWDLAKKADSLDILLILAGYILMHTTFFLLIVRSRKLGSSFWLPLAIVSSAILSLLISLPIAMALRIPIDP
VALTEALPFLVCTIGFDKPLRLARTVFTHPHLLTAPTPGAQMKPAPKIITESLTKVYSPIIRDYFLEIAVLVVGA
YSKVGGLKEVCALAAIILGVDCILLCTYLAAILGIMIDVRRIKTARAMTRSSLSRSSSTSSLASGFNLKTLSAAS
GKPSALANGRSKLSSVKEPASPKGLRQRLSALLGEKGSGLIQSMENAGSTKTGSPTKQENPVARLKLLLIASFTT
LHILNLITPLTPTRHATHHPTTVNIRRVDLNTSALRPVLQALADDASVVLEVNDDVASVDGEEQQLARDLWVKVS
PPVYIRCHPASSTLAQHRSTSSNSFTRRRQQSSTSFTLERRRKTAWEVVESFMSSWTRLVGDPVLSKWIVVLLAI
SISLNGFLLKGIALGLPVVGRSGAKGGVRFEEEEEEKKGEVVLKEKEETLKVRTSSSDASATPTAISPAATLIST
TPAPPPPLFVPVPKAAVAPINFTIEDVDRKLKAAAASLHTPPLSDSGVHTPPHDTIRTLEECIDVFENGPRPLSS
SMKMLNDEEVILLARNGKIAMYALEKVLGMDQLERAVRIRRALVSRQSRTKTLEESDVPLMNYDYSRVLGACCEN
VVGYIPLPLGIAGPLNVDGQMIHIPMATAEGTLVASTSRGCKALNAGGGVITVLTQDGMTRGPAVDFPSITLAAQ
AKAWIASEEGYATLKTAFESTSRFAKLQSLKTTLAGRTLFVRFATATGDAMGMNMISKGTEKALEALQQQFPEMV
TLALSGNYCTDKKPAAINWIEGRGKSVVAEAVIPGKVVKSVLKTTVEALCNLNTKKNLVGSAMAGSIGGFNAHAA
NILTAMFIATGQDPAQNVESSNCITLMEAINDGEDLLMTVSMPSIEVGTVGGGTVLAPQQAVLDMLGVRGAHPTH
PGQNAQALARIIAAAVMAGELSLISALAAGHLIRAHMAHNRSQTNTPSTSRPATPGPGPSPVSGHFASVPATAVD
SGKKSALLTPVESIASSPLRSDVNLSSSSSASTNQIPSST*
Coding >AgabiH97|019200
ATGCGCTTTCTCCTGCGGCCTTTTGCGCTGCACGCCGCGTACACACCAATAGAGACTATCGTCTTCTTCACCATC
GTCGGCACCCTCGCCTATTTCCACATCCTCAACGCCATAAAACACTCTGCCTTCCTCGCGCCTCACAACTCCCCC
GCCTCTCTCCGCCCCGCACACGCCCTCTTCCATGCTGGAGAGTGGGTACCCGTCAGAGAGTCTGCCTGGGCCTCA
GCTGCTGCGGACAGACGCGCCACTTCTCTCGAACTCCAGCAACTCATCGTGTCTCTCGACTCCCAGATTATTCCT
GAGTCTATTTCTCTGCTAGACGCTCCCCTATCGGCCTCGGCCCACAACCTCACTCAGCACCTTACCACTACCTTT
GCCTCTGCAACTAACCGGAAATACCCCAGCATATGCCATCGTCCTTTCAACACCTCCCTCTCTACTTGCTTCGCC
CACCAACATTCTTCTTCCCACTCCCTGGTGCAGACATTGGCATTTGTTCCAGGTGCCCCACGAGACGAATGGATT
TCCGCACTCACAGCCAATGAGCTGGGTGGACGCGTCTTCACAGACGAATCCGGCGTCGAGTTCCAGGTCGAATCC
GCTCGTACCGCTGCCGATCACGTCCCTATAGTTCGAATGAAATCCCCCACATGGGTTGCATACGCCGCGGGCACG
ATGGTCGTCCGTTTCTGGGACCTCGCCAAGAAAGCAGACTCTCTTGACATCCTCCTTATACTTGCCGGATATATC
CTCATGCATACGACCTTCTTCCTCCTCATAGTACGCTCCAGGAAGCTCGGCTCCAGCTTTTGGTTGCCTCTCGCC
ATCGTTTCTAGTGCTATTCTGTCTCTCCTCATTTCCCTCCCGATTGCTATGGCTCTACGCATTCCTATCGATCCA
GTAGCACTGACAGAGGCACTTCCGTTCCTTGTTTGTACCATCGGTTTCGATAAACCTCTTCGCCTGGCACGCACC
GTATTCACCCACCCCCACCTTCTTACTGCTCCCACCCCCGGAGCCCAAATGAAACCCGCTCCCAAAATTATCACG
GAAAGTCTAACCAAAGTCTACTCACCGATCATCCGGGACTACTTCCTTGAGATTGCCGTTCTCGTCGTCGGCGCG
TATTCCAAAGTCGGTGGTTTGAAGGAAGTTTGCGCTTTGGCGGCAATCATTCTTGGTGTGGACTGCATTCTACTG
TGCACATATTTGGCGGCCATTCTTGGCATTATGATTGATGTCAGGAGAATTAAGACTGCCAGAGCTATGACTCGC
TCATCCTTATCTCGATCATCCTCGACGTCATCCCTTGCCAGCGGCTTCAATCTGAAAACCCTTTCTGCTGCTTCA
GGAAAGCCGTCTGCGCTTGCGAATGGCCGTTCAAAGCTATCTTCCGTCAAGGAGCCTGCATCACCTAAAGGATTA
AGACAGAGACTTAGTGCTTTGCTTGGGGAGAAGGGTTCAGGATTGATCCAGAGTATGGAAAATGCTGGTTCGACC
AAGACGGGTTCTCCGACGAAACAGGAAAACCCGGTTGCGAGATTGAAGTTACTTTTGATTGCGTCATTCACGACT
CTTCACATTCTCAACCTCATTACTCCTCTTACACCCACCCGCCATGCGACGCATCATCCGACCACCGTAAATATC
AGACGAGTCGACCTTAATACGTCTGCTCTACGGCCTGTGCTTCAAGCGCTCGCTGACGATGCGTCTGTTGTCCTA
GAGGTTAACGATGATGTAGCTTCGGTTGATGGTGAAGAACAGCAACTCGCTCGCGACCTCTGGGTCAAGGTTTCA
CCGCCCGTGTACATTCGTTGTCATCCCGCTTCATCGACTCTTGCTCAACATCGTTCCACTTCTTCCAATTCCTTC
ACACGCCGACGCCAACAGAGTTCAACTTCTTTTACTCTAGAACGTAGGCGGAAGACCGCTTGGGAAGTCGTTGAA
AGCTTCATGTCAAGCTGGACCCGACTTGTTGGTGATCCAGTTTTGTCAAAGTGGATTGTGGTTTTGTTGGCGATC
AGCATCAGTTTGAATGGGTTCTTGTTGAAGGGAATTGCTCTTGGTTTACCTGTCGTTGGACGATCTGGAGCGAAA
GGGGGAGTGAGATTTGAAGAGGAAGAAGAGGAAAAGAAAGGTGAAGTTGTTTTGAAAGAAAAGGAGGAAACGTTG
AAGGTTCGAACATCGTCAAGTGATGCTTCGGCTACTCCTACCGCAATTTCTCCTGCTGCTACACTCATATCAACC
ACACCCGCACCACCTCCTCCGCTTTTCGTCCCGGTACCCAAAGCCGCTGTCGCTCCCATCAATTTCACTATTGAA
GACGTCGATCGAAAACTCAAAGCTGCTGCTGCGTCGTTACATACACCACCTTTATCTGATTCCGGAGTTCATACC
CCTCCCCACGATACCATTCGCACGCTTGAAGAATGCATCGACGTTTTTGAAAATGGACCGAGGCCGTTGAGTTCG
AGTATGAAGATGTTGAATGATGAAGAGGTTATTTTGTTGGCTCGGAATGGGAAGATTGCGATGTATGCGTTGGAG
AAGGTTCTTGGGATGGATCAACTTGAGAGAGCTGTCAGGATCCGCAGGGCTCTTGTTTCTCGGCAATCTAGGACA
AAGACACTTGAGGAATCGGATGTTCCATTGATGAACTATGATTATTCTCGTGTTCTTGGTGCTTGCTGCGAGAAT
GTCGTTGGATATATCCCTCTTCCCCTCGGTATCGCTGGTCCTCTCAATGTTGATGGTCAGATGATTCATATTCCT
ATGGCGACTGCTGAGGGTACCCTCGTCGCGTCGACGTCCCGTGGTTGTAAAGCTCTCAACGCCGGTGGAGGCGTG
ATTACTGTTCTCACTCAAGATGGTATGACTCGTGGTCCTGCCGTTGATTTCCCTTCCATCACTCTCGCTGCACAA
GCTAAAGCCTGGATCGCTTCGGAAGAGGGCTATGCTACACTCAAAACTGCTTTTGAATCGACGTCGAGGTTTGCG
AAGTTGCAGAGTTTGAAAACGACTCTTGCTGGGAGGACTTTGTTTGTTCGGTTTGCGACTGCGACGGGTGATGCT
ATGGGTATGAACATGATTTCGAAGGGAACGGAAAAGGCACTCGAGGCTCTGCAACAACAGTTCCCGGAGATGGTT
ACTTTGGCGTTGTCGGGTAATTATTGTACGGACAAGAAACCTGCGGCGATTAATTGGATTGAAGGGAGAGGGAAG
AGTGTTGTTGCGGAAGCAGTTATTCCTGGGAAGGTTGTCAAGTCGGTGTTGAAGACGACAGTGGAGGCGTTGTGT
AATTTGAATACGAAGAAGAATTTGGTAGGGAGTGCGATGGCGGGGTCGATTGGAGGGTTCAATGCTCATGCGGCG
AATATTTTGACGGCGATGTTTATTGCGACTGGTCAGGATCCGGCGCAGAATGTTGAGAGTTCGAATTGTATCACC
TTGATGGAAGCGATCAACGATGGCGAGGATTTATTGATGACTGTTTCTATGCCTTCGATTGAAGTCGGTACCGTT
GGTGGTGGAACTGTCCTCGCTCCTCAACAGGCCGTATTGGATATGCTCGGTGTTAGAGGCGCACATCCTACACAT
CCCGGACAGAATGCGCAAGCTTTGGCTAGGATAATCGCTGCTGCTGTCATGGCTGGTGAACTGTCGTTGATCAGT
GCTCTTGCCGCTGGTCATTTGATTAGAGCACATATGGCACATAATAGGAGTCAAACGAATACGCCGTCGACTTCG
AGACCTGCGACTCCTGGACCTGGACCAAGTCCTGTTTCAGGGCATTTTGCTAGCGTGCCGGCTACTGCTGTTGAT
AGTGGGAAGAAGTCGGCGTTGCTTACGCCTGTGGAGTCGATAGCTTCGTCGCCGCTGAGATCAGACGTGAATCTT
TCAAGTTCAAGCTCGGCTTCGACAAATCAGATACCCTCATCTACATGA
Transcript >AgabiH97|019200
ATGCGCTTTCTCCTGCGGCCTTTTGCGCTGCACGCCGCGTACACACCAATAGAGACTATCGTCTTCTTCACCATC
GTCGGCACCCTCGCCTATTTCCACATCCTCAACGCCATAAAACACTCTGCCTTCCTCGCGCCTCACAACTCCCCC
GCCTCTCTCCGCCCCGCACACGCCCTCTTCCATGCTGGAGAGTGGGTACCCGTCAGAGAGTCTGCCTGGGCCTCA
GCTGCTGCGGACAGACGCGCCACTTCTCTCGAACTCCAGCAACTCATCGTGTCTCTCGACTCCCAGATTATTCCT
GAGTCTATTTCTCTGCTAGACGCTCCCCTATCGGCCTCGGCCCACAACCTCACTCAGCACCTTACCACTACCTTT
GCCTCTGCAACTAACCGGAAATACCCCAGCATATGCCATCGTCCTTTCAACACCTCCCTCTCTACTTGCTTCGCC
CACCAACATTCTTCTTCCCACTCCCTGGTGCAGACATTGGCATTTGTTCCAGGTGCCCCACGAGACGAATGGATT
TCCGCACTCACAGCCAATGAGCTGGGTGGACGCGTCTTCACAGACGAATCCGGCGTCGAGTTCCAGGTCGAATCC
GCTCGTACCGCTGCCGATCACGTCCCTATAGTTCGAATGAAATCCCCCACATGGGTTGCATACGCCGCGGGCACG
ATGGTCGTCCGTTTCTGGGACCTCGCCAAGAAAGCAGACTCTCTTGACATCCTCCTTATACTTGCCGGATATATC
CTCATGCATACGACCTTCTTCCTCCTCATAGTACGCTCCAGGAAGCTCGGCTCCAGCTTTTGGTTGCCTCTCGCC
ATCGTTTCTAGTGCTATTCTGTCTCTCCTCATTTCCCTCCCGATTGCTATGGCTCTACGCATTCCTATCGATCCA
GTAGCACTGACAGAGGCACTTCCGTTCCTTGTTTGTACCATCGGTTTCGATAAACCTCTTCGCCTGGCACGCACC
GTATTCACCCACCCCCACCTTCTTACTGCTCCCACCCCCGGAGCCCAAATGAAACCCGCTCCCAAAATTATCACG
GAAAGTCTAACCAAAGTCTACTCACCGATCATCCGGGACTACTTCCTTGAGATTGCCGTTCTCGTCGTCGGCGCG
TATTCCAAAGTCGGTGGTTTGAAGGAAGTTTGCGCTTTGGCGGCAATCATTCTTGGTGTGGACTGCATTCTACTG
TGCACATATTTGGCGGCCATTCTTGGCATTATGATTGATGTCAGGAGAATTAAGACTGCCAGAGCTATGACTCGC
TCATCCTTATCTCGATCATCCTCGACGTCATCCCTTGCCAGCGGCTTCAATCTGAAAACCCTTTCTGCTGCTTCA
GGAAAGCCGTCTGCGCTTGCGAATGGCCGTTCAAAGCTATCTTCCGTCAAGGAGCCTGCATCACCTAAAGGATTA
AGACAGAGACTTAGTGCTTTGCTTGGGGAGAAGGGTTCAGGATTGATCCAGAGTATGGAAAATGCTGGTTCGACC
AAGACGGGTTCTCCGACGAAACAGGAAAACCCGGTTGCGAGATTGAAGTTACTTTTGATTGCGTCATTCACGACT
CTTCACATTCTCAACCTCATTACTCCTCTTACACCCACCCGCCATGCGACGCATCATCCGACCACCGTAAATATC
AGACGAGTCGACCTTAATACGTCTGCTCTACGGCCTGTGCTTCAAGCGCTCGCTGACGATGCGTCTGTTGTCCTA
GAGGTTAACGATGATGTAGCTTCGGTTGATGGTGAAGAACAGCAACTCGCTCGCGACCTCTGGGTCAAGGTTTCA
CCGCCCGTGTACATTCGTTGTCATCCCGCTTCATCGACTCTTGCTCAACATCGTTCCACTTCTTCCAATTCCTTC
ACACGCCGACGCCAACAGAGTTCAACTTCTTTTACTCTAGAACGTAGGCGGAAGACCGCTTGGGAAGTCGTTGAA
AGCTTCATGTCAAGCTGGACCCGACTTGTTGGTGATCCAGTTTTGTCAAAGTGGATTGTGGTTTTGTTGGCGATC
AGCATCAGTTTGAATGGGTTCTTGTTGAAGGGAATTGCTCTTGGTTTACCTGTCGTTGGACGATCTGGAGCGAAA
GGGGGAGTGAGATTTGAAGAGGAAGAAGAGGAAAAGAAAGGTGAAGTTGTTTTGAAAGAAAAGGAGGAAACGTTG
AAGGTTCGAACATCGTCAAGTGATGCTTCGGCTACTCCTACCGCAATTTCTCCTGCTGCTACACTCATATCAACC
ACACCCGCACCACCTCCTCCGCTTTTCGTCCCGGTACCCAAAGCCGCTGTCGCTCCCATCAATTTCACTATTGAA
GACGTCGATCGAAAACTCAAAGCTGCTGCTGCGTCGTTACATACACCACCTTTATCTGATTCCGGAGTTCATACC
CCTCCCCACGATACCATTCGCACGCTTGAAGAATGCATCGACGTTTTTGAAAATGGACCGAGGCCGTTGAGTTCG
AGTATGAAGATGTTGAATGATGAAGAGGTTATTTTGTTGGCTCGGAATGGGAAGATTGCGATGTATGCGTTGGAG
AAGGTTCTTGGGATGGATCAACTTGAGAGAGCTGTCAGGATCCGCAGGGCTCTTGTTTCTCGGCAATCTAGGACA
AAGACACTTGAGGAATCGGATGTTCCATTGATGAACTATGATTATTCTCGTGTTCTTGGTGCTTGCTGCGAGAAT
GTCGTTGGATATATCCCTCTTCCCCTCGGTATCGCTGGTCCTCTCAATGTTGATGGTCAGATGATTCATATTCCT
ATGGCGACTGCTGAGGGTACCCTCGTCGCGTCGACGTCCCGTGGTTGTAAAGCTCTCAACGCCGGTGGAGGCGTG
ATTACTGTTCTCACTCAAGATGGTATGACTCGTGGTCCTGCCGTTGATTTCCCTTCCATCACTCTCGCTGCACAA
GCTAAAGCCTGGATCGCTTCGGAAGAGGGCTATGCTACACTCAAAACTGCTTTTGAATCGACGTCGAGGTTTGCG
AAGTTGCAGAGTTTGAAAACGACTCTTGCTGGGAGGACTTTGTTTGTTCGGTTTGCGACTGCGACGGGTGATGCT
ATGGGTATGAACATGATTTCGAAGGGAACGGAAAAGGCACTCGAGGCTCTGCAACAACAGTTCCCGGAGATGGTT
ACTTTGGCGTTGTCGGGTAATTATTGTACGGACAAGAAACCTGCGGCGATTAATTGGATTGAAGGGAGAGGGAAG
AGTGTTGTTGCGGAAGCAGTTATTCCTGGGAAGGTTGTCAAGTCGGTGTTGAAGACGACAGTGGAGGCGTTGTGT
AATTTGAATACGAAGAAGAATTTGGTAGGGAGTGCGATGGCGGGGTCGATTGGAGGGTTCAATGCTCATGCGGCG
AATATTTTGACGGCGATGTTTATTGCGACTGGTCAGGATCCGGCGCAGAATGTTGAGAGTTCGAATTGTATCACC
TTGATGGAAGCGATCAACGATGGCGAGGATTTATTGATGACTGTTTCTATGCCTTCGATTGAAGTCGGTACCGTT
GGTGGTGGAACTGTCCTCGCTCCTCAACAGGCCGTATTGGATATGCTCGGTGTTAGAGGCGCACATCCTACACAT
CCCGGACAGAATGCGCAAGCTTTGGCTAGGATAATCGCTGCTGCTGTCATGGCTGGTGAACTGTCGTTGATCAGT
GCTCTTGCCGCTGGTCATTTGATTAGAGCACATATGGCACATAATAGGAGTCAAACGAATACGCCGTCGACTTCG
AGACCTGCGACTCCTGGACCTGGACCAAGTCCTGTTTCAGGGCATTTTGCTAGCGTGCCGGCTACTGCTGTTGAT
AGTGGGAAGAAGTCGGCGTTGCTTACGCCTGTGGAGTCGATAGCTTCGTCGCCGCTGAGATCAGACGTGAATCTT
TCAAGTTCAAGCTCGGCTTCGACAAATCAGATACCCTCATCTACATGA
Gene >AgabiH97|019200
ATGCGCTTTCTCCTGCGGCCTTTTGCGCTGCACGCCGCGTACACACCAATAGAGACTATCGTCTTCTTCACCATC
GTCGGCACCCTCGCCTATTTCCACATCCTCAACGCCATAAAACACTCTGCCTTCCTCGCGCCTCACAACTCCCCC
GCCTCTCTCCGCCCCGCACACGCCCTCTTCCATGCTGGAGAGTGGGTACCCGTCAGAGAGTCTGCCTGGGCCTCA
GCTGCTGCGGACAGACGCGCCACTTCTCTCGAACTCCAGCAACTCATCGTGTCTCTCGACTCCCAGGTGCGCATT
GTCAACTTGGACTTTGCTTCAATTCTGACATGACTCTATAGATTATTCCTGAGTCTATTTCTCTGCTAGACGCTC
CCCTATCGGCCTCGGCCCACAACCTCACTCAGCACCTTACCACTACCTTTGCCTCTGCAACTAACCGGAAATACC
CCAGCATATGCCATCGTCCTTTCAACACCTCCCTCTCTACTTGCTTCGCCCACCAACATTCTTCTTCCCACTCCC
TGGTGCAGACATTGGCATTTGTTCCAGGTGCCCCACGAGACGAATGGATTTCCGCACTCACAGCCAATGAGCTGG
GTGGACGCGTCTTCACAGACGAATCCGGCGTCGAGTTCCAGGTCGAATCCGCTCGTACCGCTGCCGATCACGTCC
CTATAGTTCGAATGAAATCCCCCACATGGGTTGCATACGCCGCGGGCACGATGGTCGTCCGTTTCTGGGACCTCG
CCAAGAAAGCAGACTCTCTTGACATCCTCCTTATACTTGCCGGATATATCCTCATGCATACGACCTTCTTCCTCC
TCATAGTACGCTCCAGGAAGCTCGGCTCCAGCTTTTGGTTGCCTCTCGCCATCGTTTCTAGTGCTATTCTGTCTC
TCCTCATTTCCCTCCCGATTGCTATGGCTCTACGCATTCCTATCGATCCAGTAGCACTGACAGAGGCACTTCCGT
TCCTTGTTTGTACCATCGGTTTCGATAAACCTCTTCGCCTGGCACGCACCGTATTCACCCACCCCCACCTTCTTA
CTGCTCCCACCCCCGGAGCCCAAATGAAACCCGCTCCCAAAATTATCACGGAAAGTCTAACCAAAGTCTACTCAC
CGATCATCCGGGACTACTTCCTTGAGATTGCCGTTCTCGTCGTCGGCGCGTATTCCAAAGTCGGTGGTTTGAAGG
AAGTTTGCGCTTTGGCGGCAATCATTCTTGGTGTGGACTGCATTCTACTGTGCACATATTTGGCGGCCATTCTTG
GCATTATGATTGATGTGAGTTTCTACCTCCATTCTTGAGTTTCATTACCGGGCCCTTCTGTGCTCTTTCGTTCTT
TTTTTGTTTTGTTCTGAAACGACAATATTGTCGTACCACACCCATTTCCAAAATATGGTGTCCGGGGGACCTTGC
GAGAGTGACCGCGTTCCTGATTCATCATATCCCGAACTCTTTCTCATCGTCGCCCCGTTCATGGATCCGGGCGCG
GTAGATCCGGAATCTGATTGCACAGCACTCCCATATGCAGCATTCAAGCTGTTTGGGTTTCTTCGGTGCGCTTGA
ATGAGCGGATTTAGTTCCAATTGACGGATCGGGAAGTGGAGGTGACACTATACGGTGTCAACCGGGAACTGATAC
CCAGCTACACATCATTGTCAGCCGTCGGTGGACACCGAAAATGACGAGACCGACGTCAGCTACCCACATAGGGTT
ACCGGTCGTGTGGGCGGTGTACACGGTGATGTCCATCCCACATTCGTTGTCGCGGCCACTGCTGGGGTCTCTTGT
GTCGTATCGGGCCTGATTTGGCCATAAGACGGCCCCGATCTTATCATTGGTTGCTTTTTGTTGCGACCGGCTTTG
ATCGCGGTCTGTGTGGGTAAGAGAAGGCCAAGTGGGTCTCGCGCGAGGAACTCTAATTGTTGACGACCGTTTTGG
ATTGGCTGTCATACAAATAAGGCGATGGCGCTGATCTTTGGTATTGCCTGCTTGGGGCGCTTTCCATCTTTCACT
TTCATTTCTTTGTGGCTTTTGTTCTTCTACCCTATACAGGAATTGGGTCGTGCTAACCAATTCATACTCTATACA
GGTCAGGAGAATTAAGACTGCCAGAGCTATGACTCGCTCATCCTTATCTCGATCATCCTCGACGTCATCCCTTGC
CAGCGGCTTCAATCTGAAAACCCTTTCTGCTGCTTCAGGAAAGCCGTCTGCGCTTGCGAATGGCCGTTCAAAGCT
ATCTTCCGTCAAGGAGCCTGCATCACCTAAAGGATTAAGACAGAGACTTAGTGCTTTGCTTGGGGAGAAGGGTTC
AGGATTGATCCAGAGTATGGAAAATGCTGGTTCGACCAAGACGGGTTCTCCGACGAAACAGGAAAACCCGGTTGC
GAGATTGAAGTTACTTTTGGTACGATTATTTCCCTTGGTGGCTCGCATACGGTTATTGACTGTTTGGCAGATTGC
GTCATTCACGACTCTTCACATTCTCAACCTCATTACTCCTCTTACACCCACCCGCCATGCGACGCATCATCCGAC
CACCGTAAATATCAGACGAGTCGACCTTAATACGTCTGCTCTACGGCCTGTGCTTCAAGCGCTCGCTGACGATGC
GTCTGTTGTCCTAGAGGTTAACGATGATGTAGCTTCGGTTGATGGTGAAGAACAGCAACTCGCTCGCGACCTCTG
GGTCAAGGTTTCACCGCCCGTGTACATTCGTTGTCATCCCGCTTCATCGACTCTTGCTCAACATCGTTCCACTTC
TTCCAATTCCTTCACACGCCGACGCCAACAGAGTTCAACTTCTTTTACTCTAGAACGTAGGCGGAAGACCGCTTG
GGAAGTCGTTGAAAGCTTCATGTCAAGCTGGACCCGACTTGTTGGTGATCCAGTTTTGTCAAAGTGGATTGTGGT
TTTGTTGGCGATCAGCATCAGTTTGAATGGGTTCTTGTTGAAGGGAATTGCTCTTGGTTTACCTGTCGTTGGACG
ATCTGGAGCGAAAGGGGGAGTGAGATTTGAAGAGGAAGAAGAGGAAAAGAAAGGTGAAGTTGTTTTGAAAGAAAA
GGAGGAAACGTTGAAGGTTCGAACATCGTCAAGTGATGCTTCGGCTACTCCTACCGCAATTTCTCCTGCTGCTAC
ACTCATATCAACCACACCCGCACCACCTCCTCCGCTTTTCGTCCCGGTACCCAAAGCCGCTGTCGCTCCCATCAA
TTTCACTATTGAAGACGTCGATCGAAAACTCAAAGCTGCTGCTGCGTCGTTACATACACCACCTTTATCTGATTC
CGGAGTTCATACCCCTCCCCACGATACCATTCGCACGCTTGAAGAATGCATCGACGTTTTTGAAAATGGACCGAG
GCCGTTGAGTTCGAGTATGAAGATGTTGAATGATGAAGAGGTTATTTTGTTGGCTCGGAATGGGAAGATTGCGAT
GTATGCGTTGGAGAAGGTTCTTGGGATGGATCAACTTGAGAGAGCTGTCAGGATCCGCAGGGCTCTTGTTTGTAA
GTTTTTCTCTTCCTTTTTTATTTATGATCTGGTTATTGATGAGTATTGTAGCTCGGCAATCTAGGACAAAGACAC
TTGAGGAATCGGATGTTCCATTGATGAACTATGATTATTCTCGTGTTCTTGGTGCTTGCTGCGAGAATGTCGTTG
GATATATCCCTCTTCCCCTCGGTATCGCTGGTCCTCTCAATGTTGATGGTCAGATGATTCATATTCCTATGGCGA
CTGCTGAGGGTACCCTCGTCGCGTCGACGTCCCGTGGTTGTAAAGCTCTCAACGCCGGTGGAGGCGTGATTACTG
TTCTCACTCAAGATGGTATGACTCGTGGTCCTGCCGTTGATTTCCCTTCCATCACTCTCGCTGCACAAGCTAAAG
CCTGGATCGCTTCGGAAGAGGGCTATGCTACACTCAAAACTGCTTTTGAATCGACGTCGAGGTTTGCGAAGTTGC
AGAGTTTGAAAACGACTCTTGCTGGGAGGACTTTGTTTGTTCGGTTTGCGACTGCGACGGGTGATGCTATGGGTA
TGAACATGATTTCGAAGGGAACGGAAAAGGCACTCGAGGCTCTGCAACAACAGTTCCCGGAGATGGTTACTTTGG
CGTTGTCGGGTAATTATTGTACGGACAAGAAACCTGCGGCGATTAATTGGATTGAAGGGAGAGGGAAGAGTGTTG
TTGCGGAAGCAGTTATTCCTGGGAAGGTTGTCAAGTCGGTGTTGAAGACGACAGTGGAGGCGTTGTGTAATTTGA
ATACGAAGAAGAATTTGGTAGGGAGTGCGATGGCGGGGTCGATTGGAGGGTTCAATGCTCATGCGGCGAATATTT
TGACGGCGATGTTTATTGCGACTGGTCAGGATCCGGCGCAGAATGTTGAGAGTTCGAATTGTATCACCTTGATGG
AAGCGTACGTCGCTTTTTCATTTTCTATCTTGCGGTTATGGGAAACTTAATGGGTTGTCTTTTTTAGGATCAACG
ATGGCGAGGATTTATTGATGACTGTTTCTATGCCTTCGATTGAAGTCGGTACCGTTGGTGGTGGAACTGTCCTCG
CTCCTCAACAGGCCGTATTGGATATGCTCGGTGTTAGAGGCGCACATCCTACACATCCCGGACAGAATGCGCAAG
CTTTGGCTAGGATAATCGCTGCTGCTGTCATGGCTGGTGAACTGTCGTTGATCAGTGCTCTTGCCGCTGGTCATT
TGATTAGAGCACATATGGCACATAATAGGAGTCAAACGAATACGCCGTCGACTTCGAGACCTGCGACTCCTGGAC
CTGGACCAAGTCCTGTTTCAGGGCATTTTGCTAGCGTGCCGGCTACTGCTGTTGATAGTGGGAAGAAGTCGGCGT
TGCTTACGCCTGTGGAGTCGATAGCTTCGTCGCCGCTGAGATCAGACGTGAATCTTTCAAGTTCAAGCTCGGCTT
CGACAAATCAGATACCCTCATCTACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail