Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|018900
Gene name
Locationscaffold_10:1049400..1052272
Strand-
Gene length (bp)2872
Transcript length (bp)2205
Coding sequence length (bp)2205
Protein length (aa) 735

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16413 Mlh1_C DNA mismatch repair protein Mlh1 C-terminus 3.6E-91 484 734
PF01119 DNA_mis_repair DNA mismatch repair protein, C-terminal domain 1.6E-26 261 367
PF13589 HATPase_c_3 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 9.1E-12 32 128
PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 1.3E-07 34 111

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40692|MLH1_HUMAN DNA mismatch repair protein Mlh1 OS=Homo sapiens GN=MLH1 PE=1 SV=1 12 734 0.0E+00
sp|Q9JK91|MLH1_MOUSE DNA mismatch repair protein Mlh1 OS=Mus musculus GN=Mlh1 PE=1 SV=2 12 734 0.0E+00
sp|P97679|MLH1_RAT DNA mismatch repair protein Mlh1 OS=Rattus norvegicus GN=Mlh1 PE=2 SV=1 12 734 2.0E-172
sp|Q9ZRV4|MLH1_ARATH DNA mismatch repair protein MLH1 OS=Arabidopsis thaliana GN=MLH1 PE=2 SV=1 9 734 4.0E-144
sp|Q9P7W6|MLH1_SCHPO Putative MutL protein homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mlh1 PE=2 SV=1 12 734 4.0E-144
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40692|MLH1_HUMAN DNA mismatch repair protein Mlh1 OS=Homo sapiens GN=MLH1 PE=1 SV=1 12 734 0.0E+00
sp|Q9JK91|MLH1_MOUSE DNA mismatch repair protein Mlh1 OS=Mus musculus GN=Mlh1 PE=1 SV=2 12 734 0.0E+00
sp|P97679|MLH1_RAT DNA mismatch repair protein Mlh1 OS=Rattus norvegicus GN=Mlh1 PE=2 SV=1 12 734 2.0E-172
sp|Q9ZRV4|MLH1_ARATH DNA mismatch repair protein MLH1 OS=Arabidopsis thaliana GN=MLH1 PE=2 SV=1 9 734 4.0E-144
sp|Q9P7W6|MLH1_SCHPO Putative MutL protein homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mlh1 PE=2 SV=1 12 734 4.0E-144
sp|Q54KD8|MLH1_DICDI DNA mismatch repair protein Mlh1 OS=Dictyostelium discoideum GN=mlh1 PE=3 SV=1 10 443 2.0E-107
sp|P38920|MLH1_YEAST DNA mismatch repair protein MLH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MLH1 PE=1 SV=2 12 383 4.0E-104
sp|B8CX97|MUTL_HALOH DNA mismatch repair protein MutL OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=mutL PE=3 SV=1 12 361 3.0E-63
sp|A4IMI1|MUTL_GEOTN DNA mismatch repair protein MutL OS=Geobacillus thermodenitrificans (strain NG80-2) GN=mutL PE=3 SV=1 12 367 8.0E-60
sp|Q5FLX4|MUTL_LACAC DNA mismatch repair protein MutL OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=mutL PE=3 SV=1 9 425 1.0E-59
sp|Q02VS5|MUTL_LACLS DNA mismatch repair protein MutL OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=mutL PE=3 SV=1 12 368 2.0E-57
sp|B0TB10|MUTL_HELMI DNA mismatch repair protein MutL OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=mutL PE=3 SV=1 12 367 3.0E-57
sp|Q5L0E4|MUTL_GEOKA DNA mismatch repair protein MutL OS=Geobacillus kaustophilus (strain HTA426) GN=mutL PE=3 SV=1 12 398 5.0E-57
sp|B9EBI5|MUTL_MACCJ DNA mismatch repair protein MutL OS=Macrococcus caseolyticus (strain JCSC5402) GN=mutL PE=3 SV=1 12 381 5.0E-57
sp|A2RP08|MUTL_LACLM DNA mismatch repair protein MutL OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=mutL PE=3 SV=1 12 368 7.0E-57
sp|B7GIA3|MUTL_ANOFW DNA mismatch repair protein MutL OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=mutL PE=3 SV=1 12 411 8.0E-57
sp|A0AIK6|MUTL_LISW6 DNA mismatch repair protein MutL OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=mutL PE=3 SV=1 10 365 5.0E-56
sp|Q92BV2|MUTL_LISIN DNA mismatch repair protein MutL OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=mutL PE=3 SV=1 10 364 6.0E-56
sp|Q5M6H7|MUTL_STRT2 DNA mismatch repair protein MutL OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=mutL PE=3 SV=1 9 367 7.0E-56
sp|Q5M1Y6|MUTL_STRT1 DNA mismatch repair protein MutL OS=Streptococcus thermophilus (strain CNRZ 1066) GN=mutL PE=3 SV=1 9 367 7.0E-56
sp|Q03MY0|MUTL_STRTD DNA mismatch repair protein MutL OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=mutL PE=3 SV=1 9 367 9.0E-56
sp|B8DFS3|MUTL_LISMH DNA mismatch repair protein MutL OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=mutL PE=3 SV=1 10 365 2.0E-55
sp|Q8Y788|MUTL_LISMO DNA mismatch repair protein MutL OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=mutL PE=3 SV=1 10 365 2.0E-55
sp|C5D9H6|MUTL_GEOSW DNA mismatch repair protein MutL OS=Geobacillus sp. (strain WCH70) GN=mutL PE=3 SV=1 12 376 3.0E-55
sp|A8YTI0|MUTL_LACH4 DNA mismatch repair protein MutL OS=Lactobacillus helveticus (strain DPC 4571) GN=mutL PE=3 SV=1 12 361 3.0E-55
sp|C1L2W0|MUTL_LISMC DNA mismatch repair protein MutL OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=mutL PE=3 SV=1 10 365 4.0E-55
sp|Q9CDL1|MUTL_LACLA DNA mismatch repair protein MutL OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=mutL PE=3 SV=2 12 368 4.0E-55
sp|B7ITM0|MUTL_BACC2 DNA mismatch repair protein MutL OS=Bacillus cereus (strain G9842) GN=mutL PE=3 SV=1 12 451 4.0E-55
sp|Q71ZR6|MUTL_LISMF DNA mismatch repair protein MutL OS=Listeria monocytogenes serotype 4b (strain F2365) GN=mutL PE=3 SV=1 10 365 4.0E-55
sp|Q81WR4|MUTL_BACAN DNA mismatch repair protein MutL OS=Bacillus anthracis GN=mutL PE=3 SV=1 12 424 1.0E-54
sp|C3L823|MUTL_BACAC DNA mismatch repair protein MutL OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=mutL PE=3 SV=1 12 424 1.0E-54
sp|C3P5H4|MUTL_BACAA DNA mismatch repair protein MutL OS=Bacillus anthracis (strain A0248) GN=mutL PE=3 SV=1 12 424 1.0E-54
sp|A9VS12|MUTL_BACWK DNA mismatch repair protein MutL OS=Bacillus weihenstephanensis (strain KBAB4) GN=mutL PE=3 SV=1 12 364 1.0E-54
sp|B7JJ46|MUTL_BACC0 DNA mismatch repair protein MutL OS=Bacillus cereus (strain AH820) GN=mutL PE=3 SV=1 12 424 1.0E-54
sp|B7HLA2|MUTL_BACC7 DNA mismatch repair protein MutL OS=Bacillus cereus (strain AH187) GN=mutL PE=3 SV=1 12 424 1.0E-54
sp|A0RHE0|MUTL_BACAH DNA mismatch repair protein MutL OS=Bacillus thuringiensis (strain Al Hakam) GN=mutL PE=3 SV=1 12 424 2.0E-54
sp|B9DW70|MUTL_STRU0 DNA mismatch repair protein MutL OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=mutL PE=3 SV=1 12 370 2.0E-54
sp|Q636Q8|MUTL_BACCZ DNA mismatch repair protein MutL OS=Bacillus cereus (strain ZK / E33L) GN=mutL PE=3 SV=1 12 424 2.0E-54
sp|A7GR98|MUTL_BACCN DNA mismatch repair protein MutL OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=mutL PE=3 SV=1 12 424 2.0E-54
sp|B4SGC3|MUTL_PELPB DNA mismatch repair protein MutL OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=mutL PE=3 SV=1 12 370 2.0E-54
sp|Q732V8|MUTL_BACC1 DNA mismatch repair protein MutL OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=mutL PE=3 SV=1 12 424 2.0E-54
sp|B9IV58|MUTL_BACCQ DNA mismatch repair protein MutL OS=Bacillus cereus (strain Q1) GN=mutL PE=3 SV=1 12 424 2.0E-54
sp|B1YMD8|MUTL_EXIS2 DNA mismatch repair protein MutL OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=mutL PE=3 SV=1 12 370 3.0E-54
sp|Q6HF47|MUTL_BACHK DNA mismatch repair protein MutL OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=mutL PE=3 SV=1 12 364 3.0E-54
sp|C1ENZ2|MUTL_BACC3 DNA mismatch repair protein MutL OS=Bacillus cereus (strain 03BB102) GN=mutL PE=3 SV=1 12 364 3.0E-54
sp|Q81A26|MUTL_BACCR DNA mismatch repair protein MutL OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=mutL PE=3 SV=1 12 364 3.0E-54
sp|B7HDP3|MUTL_BACC4 DNA mismatch repair protein MutL OS=Bacillus cereus (strain B4264) GN=mutL PE=3 SV=1 12 364 3.0E-54
sp|Q5WFY4|MUTL_BACSK DNA mismatch repair protein MutL OS=Bacillus clausii (strain KSM-K16) GN=mutL PE=3 SV=1 12 368 4.0E-54
sp|Q045Q4|MUTL_LACGA DNA mismatch repair protein MutL OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=mutL PE=3 SV=1 12 359 7.0E-54
sp|Q01QW7|MUTL_SOLUE DNA mismatch repair protein MutL OS=Solibacter usitatus (strain Ellin6076) GN=mutL PE=3 SV=1 12 376 1.0E-53
sp|Q8DRX0|MUTL_STRMU DNA mismatch repair protein MutL OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=mutL PE=3 SV=1 12 360 1.0E-53
sp|A8AZU1|MUTL_STRGC DNA mismatch repair protein MutL OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=mutL PE=3 SV=1 12 360 2.0E-53
sp|Q8RA70|MUTL_CALS4 DNA mismatch repair protein MutL OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=mutL PE=3 SV=1 12 367 3.0E-53
sp|A3CR14|MUTL_STRSV DNA mismatch repair protein MutL OS=Streptococcus sanguinis (strain SK36) GN=mutL PE=3 SV=1 12 360 4.0E-53
sp|Q048Y5|MUTL_LACDB DNA mismatch repair protein MutL OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=mutL PE=3 SV=1 12 367 6.0E-53
sp|Q1G939|MUTL_LACDA DNA mismatch repair protein MutL OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=mutL PE=3 SV=1 12 367 6.0E-53
sp|B9DPC0|MUTL_STACT DNA mismatch repair protein MutL OS=Staphylococcus carnosus (strain TM300) GN=mutL PE=3 SV=1 12 365 1.0E-52
sp|C1CBX8|MUTL_STRZJ DNA mismatch repair protein MutL OS=Streptococcus pneumoniae (strain JJA) GN=mutL PE=3 SV=1 12 370 1.0E-52
sp|B5E6C5|MUTL_STRP4 DNA mismatch repair protein MutL OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=mutL PE=3 SV=1 12 370 1.0E-52
sp|A6TR78|MUTL_ALKMQ DNA mismatch repair protein MutL OS=Alkaliphilus metalliredigens (strain QYMF) GN=mutL PE=3 SV=1 12 368 1.0E-52
sp|B2IS10|MUTL_STRPS DNA mismatch repair protein MutL OS=Streptococcus pneumoniae (strain CGSP14) GN=mutL PE=3 SV=1 12 370 1.0E-52
sp|B8ZKC9|MUTL_STRPJ DNA mismatch repair protein MutL OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=mutL PE=3 SV=1 12 370 1.0E-52
sp|Q04MR4|MUTL_STRP2 DNA mismatch repair protein MutL OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=mutL PE=3 SV=1 12 370 1.0E-52
sp|P0A3R2|HEXB_STRR6 DNA mismatch repair protein HexB OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=hexB PE=3 SV=1 12 370 1.0E-52
sp|P0A3R1|HEXB_STRPN DNA mismatch repair protein HexB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=hexB PE=3 SV=1 12 370 1.0E-52
sp|B1I8F2|MUTL_STRPI DNA mismatch repair protein MutL OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=mutL PE=3 SV=1 12 370 2.0E-52
sp|Q3JYM6|MUTL_STRA1 DNA mismatch repair protein MutL OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=mutL PE=3 SV=1 12 367 2.0E-52
sp|C1CP43|MUTL_STRZT DNA mismatch repair protein MutL OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=mutL PE=3 SV=1 12 370 2.0E-52
sp|C1CI68|MUTL_STRZP DNA mismatch repair protein MutL OS=Streptococcus pneumoniae (strain P1031) GN=mutL PE=3 SV=1 12 370 2.0E-52
sp|P44494|MUTL_HAEIN DNA mismatch repair protein MutL OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=mutL PE=3 SV=1 11 551 2.0E-52
sp|B0K1A3|MUTL_THEPX DNA mismatch repair protein MutL OS=Thermoanaerobacter sp. (strain X514) GN=mutL PE=3 SV=1 12 359 2.0E-52
sp|C4L192|MUTL_EXISA DNA mismatch repair protein MutL OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=mutL PE=3 SV=1 12 367 3.0E-52
sp|Q8E2R5|MUTL_STRA3 DNA mismatch repair protein MutL OS=Streptococcus agalactiae serotype III (strain NEM316) GN=mutL PE=3 SV=1 12 367 3.0E-52
sp|A5UFN4|MUTL_HAEIG DNA mismatch repair protein MutL OS=Haemophilus influenzae (strain PittGG) GN=mutL PE=3 SV=1 11 551 3.0E-52
sp|A2RGV3|MUTL_STRPG DNA mismatch repair protein MutL OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=mutL PE=3 SV=1 12 370 3.0E-52
sp|B5XJ09|MUTL_STRPZ DNA mismatch repair protein MutL OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=mutL PE=3 SV=1 12 370 3.0E-52
sp|Q74KW0|MUTL_LACJO DNA mismatch repair protein MutL OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=mutL PE=3 SV=1 12 359 3.0E-52
sp|P0DC59|MUTL_STRPQ DNA mismatch repair protein MutL OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=mutL PE=3 SV=1 12 370 3.0E-52
sp|P0DC58|MUTL_STRP3 DNA mismatch repair protein MutL OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=mutL PE=3 SV=1 12 370 3.0E-52
sp|Q5X9H5|MUTL_STRP6 DNA mismatch repair protein MutL OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=mutL PE=3 SV=2 12 370 3.0E-52
sp|Q99XN7|MUTL_STRP1 DNA mismatch repair protein MutL OS=Streptococcus pyogenes serotype M1 GN=mutL PE=3 SV=1 12 370 3.0E-52
sp|Q6GHD9|MUTL_STAAR DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain MRSA252) GN=mutL PE=3 SV=1 12 365 5.0E-52
sp|B0K9L6|MUTL_THEP3 DNA mismatch repair protein MutL OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=mutL PE=3 SV=1 12 359 5.0E-52
sp|Q8NZ25|MUTL_STRP8 DNA mismatch repair protein MutL OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=mutL PE=3 SV=1 12 370 5.0E-52
sp|Q8NWX9|MUTL_STAAW DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain MW2) GN=mutL PE=3 SV=1 12 365 5.0E-52
sp|Q6G9R7|MUTL_STAAS DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain MSSA476) GN=mutL PE=3 SV=1 12 365 5.0E-52
sp|A5UB71|MUTL_HAEIE DNA mismatch repair protein MutL OS=Haemophilus influenzae (strain PittEE) GN=mutL PE=3 SV=1 11 551 6.0E-52
sp|A8Z1W7|MUTL_STAAT DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=mutL PE=3 SV=1 12 365 6.0E-52
sp|A6QGJ5|MUTL_STAAE DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain Newman) GN=mutL PE=3 SV=1 12 365 6.0E-52
sp|Q5HGD5|MUTL_STAAC DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain COL) GN=mutL PE=3 SV=1 12 365 6.0E-52
sp|Q93T05|MUTL_STAA8 DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain NCTC 8325) GN=mutL PE=3 SV=2 12 365 6.0E-52
sp|Q2FHE2|MUTL_STAA3 DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain USA300) GN=mutL PE=3 SV=1 12 365 6.0E-52
sp|Q1JJH1|MUTL_STRPC DNA mismatch repair protein MutL OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=mutL PE=3 SV=1 12 370 6.0E-52
sp|Q1J9C2|MUTL_STRPB DNA mismatch repair protein MutL OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=mutL PE=3 SV=1 12 370 6.0E-52
sp|P65492|MUTL_STAAN DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain N315) GN=mutL PE=1 SV=1 12 365 6.0E-52
sp|P65491|MUTL_STAAM DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=mutL PE=3 SV=1 12 365 6.0E-52
sp|A6U1B5|MUTL_STAA2 DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain JH1) GN=mutL PE=3 SV=1 12 365 6.0E-52
sp|A7X1T8|MUTL_STAA1 DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=mutL PE=3 SV=1 12 365 6.0E-52
sp|B6JIV1|MUTL_OLICO DNA mismatch repair protein MutL OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=mutL PE=3 SV=1 11 392 9.0E-52
sp|B4U0J7|MUTL_STREM DNA mismatch repair protein MutL OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=mutL PE=3 SV=1 12 367 1.0E-51
sp|Q3AUA2|MUTL_CHLCH DNA mismatch repair protein MutL OS=Chlorobium chlorochromatii (strain CaD3) GN=mutL PE=3 SV=1 12 370 1.0E-51
sp|Q03EQ8|MUTL_PEDPA DNA mismatch repair protein MutL OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=mutL PE=3 SV=1 12 368 1.0E-51
sp|C0MAS4|MUTL_STRE4 DNA mismatch repair protein MutL OS=Streptococcus equi subsp. equi (strain 4047) GN=mutL PE=3 SV=1 12 367 1.0E-51
sp|B2G6E6|MUTL_LACRJ DNA mismatch repair protein MutL OS=Lactobacillus reuteri (strain JCM 1112) GN=mutL PE=3 SV=1 12 370 2.0E-51
sp|A5VIX0|MUTL_LACRD DNA mismatch repair protein MutL OS=Lactobacillus reuteri (strain DSM 20016) GN=mutL PE=3 SV=1 12 370 2.0E-51
sp|C0MGC4|MUTL_STRS7 DNA mismatch repair protein MutL OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=mutL PE=3 SV=1 12 367 2.0E-51
sp|Q4QPH7|MUTL_HAEI8 DNA mismatch repair protein MutL OS=Haemophilus influenzae (strain 86-028NP) GN=mutL PE=3 SV=1 11 359 3.0E-51
sp|Q8CPE9|MUTL_STAES DNA mismatch repair protein MutL OS=Staphylococcus epidermidis (strain ATCC 12228) GN=mutL PE=3 SV=1 12 359 4.0E-51
sp|Q5HPP4|MUTL_STAEQ DNA mismatch repair protein MutL OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=mutL PE=3 SV=1 12 359 4.0E-51
sp|B3PDC3|MUTL_CELJU DNA mismatch repair protein MutL OS=Cellvibrio japonicus (strain Ueda107) GN=mutL PE=3 SV=1 10 368 4.0E-51
sp|A4SGM5|MUTL_CHLPM DNA mismatch repair protein MutL OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=mutL PE=3 SV=1 12 393 7.0E-51
sp|Q8F6X4|MUTL_LEPIN DNA mismatch repair protein MutL OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=mutL PE=3 SV=2 12 367 9.0E-51
sp|Q72PF7|MUTL_LEPIC DNA mismatch repair protein MutL OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=mutL PE=3 SV=2 12 367 9.0E-51
sp|Q1WT16|MUTL_LACS1 DNA mismatch repair protein MutL OS=Lactobacillus salivarius (strain UCC118) GN=mutL PE=3 SV=1 12 355 9.0E-51
sp|Q67NL0|MUTL_SYMTH DNA mismatch repair protein MutL OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=mutL PE=3 SV=1 12 368 1.0E-50
sp|Q49X89|MUTL_STAS1 DNA mismatch repair protein MutL OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=mutL PE=3 SV=1 12 369 1.0E-50
sp|B0BTY3|MUTL_ACTPJ DNA mismatch repair protein MutL OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=mutL PE=3 SV=1 10 403 2.0E-50
sp|Q04Z69|MUTL_LEPBL DNA mismatch repair protein MutL OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=mutL PE=3 SV=1 12 367 2.0E-50
sp|Q04QW2|MUTL_LEPBJ DNA mismatch repair protein MutL OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=mutL PE=3 SV=1 12 367 2.0E-50
sp|A6LEJ8|MUTL_PARD8 DNA mismatch repair protein MutL OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=mutL PE=3 SV=1 12 378 2.0E-50
sp|C1F876|MUTL_ACIC5 DNA mismatch repair protein MutL OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=mutL PE=3 SV=1 12 367 2.0E-50
sp|Q48A24|MUTL_COLP3 DNA mismatch repair protein MutL OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=mutL PE=3 SV=1 19 372 3.0E-50
sp|A8FDH4|MUTL_BACP2 DNA mismatch repair protein MutL OS=Bacillus pumilus (strain SAFR-032) GN=mutL PE=3 SV=1 12 382 4.0E-50
sp|Q3B1F8|MUTL_CHLL7 DNA mismatch repair protein MutL OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=mutL PE=3 SV=1 12 370 4.0E-50
sp|B2GB18|MUTL_LACF3 DNA mismatch repair protein MutL OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=mutL PE=3 SV=1 12 396 4.0E-50
sp|Q9KAC1|MUTL_BACHD DNA mismatch repair protein MutL OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=mutL PE=3 SV=1 12 365 5.0E-50
sp|Q74BP0|MUTL_GEOSL DNA mismatch repair protein MutL OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=mutL PE=3 SV=1 9 369 5.0E-50
sp|C1DLQ0|MUTL_AZOVD DNA mismatch repair protein MutL OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=mutL PE=3 SV=1 8 349 7.0E-50
sp|B9JSD6|MUTL_AGRVS DNA mismatch repair protein MutL OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=mutL PE=3 SV=1 12 384 7.0E-50
sp|B3EL44|MUTL_CHLPB DNA mismatch repair protein MutL OS=Chlorobium phaeobacteroides (strain BS1) GN=mutL PE=3 SV=1 12 370 9.0E-50
sp|A9M0G1|MUTL_NEIM0 DNA mismatch repair protein MutL OS=Neisseria meningitidis serogroup C (strain 053442) GN=mutL PE=3 SV=1 12 368 1.0E-49
sp|A4Z0Q5|MUTL_BRASO DNA mismatch repair protein MutL OS=Bradyrhizobium sp. (strain ORS278) GN=mutL PE=3 SV=1 11 395 1.0E-49
sp|A0B977|MUTL_METTP DNA mismatch repair protein MutL OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=mutL PE=3 SV=1 15 361 1.0E-49
sp|Q8KAX3|MUTL_CHLTE DNA mismatch repair protein MutL OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=mutL PE=3 SV=1 12 390 1.0E-49
sp|Q2VYV5|MUTL_MAGSA DNA mismatch repair protein MutL OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=mutL PE=3 SV=1 12 372 2.0E-49
sp|Q9JYT2|MUTL_NEIMB DNA mismatch repair protein MutL OS=Neisseria meningitidis serogroup B (strain MC58) GN=mutL PE=3 SV=1 12 412 2.0E-49
sp|A1AT89|MUTL_PELPD DNA mismatch repair protein MutL OS=Pelobacter propionicus (strain DSM 2379) GN=mutL PE=3 SV=1 15 352 2.0E-49
sp|A4VQP2|MUTL_PSEU5 DNA mismatch repair protein MutL OS=Pseudomonas stutzeri (strain A1501) GN=mutL PE=3 SV=1 7 349 2.0E-49
sp|Q1ILN0|MUTL_KORVE DNA mismatch repair protein MutL OS=Koribacter versatilis (strain Ellin345) GN=mutL PE=3 SV=1 12 368 2.0E-49
sp|A5D2K5|MUTL_PELTS DNA mismatch repair protein MutL OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=mutL PE=3 SV=1 15 368 2.0E-49
sp|B2RL29|MUTL_PORG3 DNA mismatch repair protein MutL OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=mutL PE=3 SV=1 12 368 2.0E-49
sp|A8I6D2|MUTL_AZOC5 DNA mismatch repair protein MutL OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=mutL PE=3 SV=1 12 349 2.0E-49
sp|Q11Z58|MUTL_CYTH3 DNA mismatch repair protein MutL OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=mutL PE=3 SV=1 12 368 3.0E-49
sp|A6SV55|MUTL_JANMA DNA mismatch repair protein MutL OS=Janthinobacterium sp. (strain Marseille) GN=mutL PE=3 SV=1 10 392 3.0E-49
sp|B3QL59|MUTL_CHLP8 DNA mismatch repair protein MutL OS=Chlorobaculum parvum (strain NCIB 8327) GN=mutL PE=3 SV=1 12 367 3.0E-49
sp|B9JA11|MUTL_AGRRK DNA mismatch repair protein MutL OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=mutL PE=3 SV=1 12 388 3.0E-49
sp|A1KUP6|MUTL_NEIMF DNA mismatch repair protein MutL OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=mutL PE=3 SV=1 12 368 4.0E-49
sp|Q1QY28|MUTL_CHRSD DNA mismatch repair protein MutL OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=mutL PE=3 SV=1 10 349 4.0E-49
sp|Q03R34|MUTL_LACBA DNA mismatch repair protein MutL OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=mutL PE=3 SV=1 9 368 7.0E-49
sp|A9KE32|MUTL_COXBN DNA mismatch repair protein MutL OS=Coxiella burnetii (strain Dugway 5J108-111) GN=mutL PE=3 SV=1 12 349 8.0E-49
sp|Q83CM9|MUTL_COXBU DNA mismatch repair protein MutL OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=mutL PE=3 SV=1 12 349 8.0E-49
sp|A9NCK3|MUTL_COXBR DNA mismatch repair protein MutL OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=mutL PE=3 SV=1 12 349 8.0E-49
sp|Q65SD7|MUTL_MANSM DNA mismatch repair protein MutL OS=Mannheimia succiniciproducens (strain MBEL55E) GN=mutL PE=3 SV=1 11 349 9.0E-49
sp|B6J016|MUTL_COXB2 DNA mismatch repair protein MutL OS=Coxiella burnetii (strain CbuG_Q212) GN=mutL PE=3 SV=1 12 349 1.0E-48
sp|B4S3X8|MUTL_PROA2 DNA mismatch repair protein MutL OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=mutL PE=3 SV=1 12 370 1.0E-48
sp|B5YE42|MUTL_DICT6 DNA mismatch repair protein MutL OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=mutL PE=3 SV=1 15 357 1.0E-48
sp|A6X3F3|MUTL_OCHA4 DNA mismatch repair protein MutL OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=mutL PE=3 SV=1 11 371 1.0E-48
sp|Q7MX15|MUTL_PORGI DNA mismatch repair protein MutL OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=mutL PE=3 SV=1 12 368 2.0E-48
sp|Q9JTS2|MUTL_NEIMA DNA mismatch repair protein MutL OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=mutL PE=3 SV=1 12 368 2.0E-48
sp|A5ECL8|MUTL_BRASB DNA mismatch repair protein MutL OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=mutL PE=3 SV=1 11 395 2.0E-48
sp|C3MGW0|MUTL_RHISN DNA mismatch repair protein MutL OS=Rhizobium sp. (strain NGR234) GN=mutL PE=3 SV=1 12 349 3.0E-48
sp|A4W5R1|MUTL_ENT38 DNA mismatch repair protein MutL OS=Enterobacter sp. (strain 638) GN=mutL PE=3 SV=1 11 366 4.0E-48
sp|Q3IDU0|MUTL_PSEHT DNA mismatch repair protein MutL OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=mutL PE=3 SV=1 12 372 4.0E-48
sp|B0UUU5|MUTL_HISS2 DNA mismatch repair protein MutL OS=Histophilus somni (strain 2336) GN=mutL PE=3 SV=1 12 349 4.0E-48
sp|B4RLX4|MUTL_NEIG2 DNA mismatch repair protein MutL OS=Neisseria gonorrhoeae (strain NCCP11945) GN=mutL PE=3 SV=1 12 368 4.0E-48
sp|A7Z4X6|MUTL_BACMF DNA mismatch repair protein MutL OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=mutL PE=3 SV=1 14 382 4.0E-48
sp|Q65JE1|MUTL_BACLD DNA mismatch repair protein MutL OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=mutL PE=3 SV=1 12 361 4.0E-48
sp|B1H0C7|MUTL_UNCTG DNA mismatch repair protein MutL OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=mutL PE=3 SV=1 11 433 5.0E-48
sp|C3KX34|MUTL_CLOB6 DNA mismatch repair protein MutL OS=Clostridium botulinum (strain 657 / Type Ba4) GN=mutL PE=3 SV=1 10 372 6.0E-48
sp|A5FW68|MUTL_ACICJ DNA mismatch repair protein MutL OS=Acidiphilium cryptum (strain JF-5) GN=mutL PE=3 SV=1 11 368 6.0E-48
sp|Q7VN43|MUTL_HAEDU DNA mismatch repair protein MutL OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=mutL PE=3 SV=1 12 369 6.0E-48
sp|Q2KX20|MUTL_BORA1 DNA mismatch repair protein MutL OS=Bordetella avium (strain 197N) GN=mutL PE=3 SV=1 10 377 6.0E-48
sp|B4F203|MUTL_PROMH DNA mismatch repair protein MutL OS=Proteus mirabilis (strain HI4320) GN=mutL PE=3 SV=1 12 349 7.0E-48
sp|Q89DE6|MUTL_BRADU DNA mismatch repair protein MutL OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=mutL PE=3 SV=1 11 372 7.0E-48
sp|A4J5Q3|MUTL_DESRM DNA mismatch repair protein MutL OS=Desulfotomaculum reducens (strain MI-1) GN=mutL PE=3 SV=1 15 359 7.0E-48
sp|A9QYN3|MUTL_YERPG DNA mismatch repair protein MutL OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mutL PE=3 SV=1 11 365 7.0E-48
sp|A7FMY1|MUTL_YERP3 DNA mismatch repair protein MutL OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mutL PE=3 SV=1 11 365 7.0E-48
sp|Q0I463|MUTL_HAES1 DNA mismatch repair protein MutL OS=Haemophilus somnus (strain 129Pt) GN=mutL PE=3 SV=1 12 349 8.0E-48
sp|B1JMP1|MUTL_YERPY DNA mismatch repair protein MutL OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mutL PE=3 SV=1 11 365 8.0E-48
sp|Q66FB7|MUTL_YERPS DNA mismatch repair protein MutL OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mutL PE=3 SV=1 11 365 8.0E-48
sp|A4TRP1|MUTL_YERPP DNA mismatch repair protein MutL OS=Yersinia pestis (strain Pestoides F) GN=mutL PE=3 SV=1 11 365 8.0E-48
sp|Q1CEF3|MUTL_YERPN DNA mismatch repair protein MutL OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=mutL PE=3 SV=1 11 365 8.0E-48
sp|Q8ZIW4|MUTL_YERPE DNA mismatch repair protein MutL OS=Yersinia pestis GN=mutL PE=3 SV=1 11 365 8.0E-48
sp|B2K202|MUTL_YERPB DNA mismatch repair protein MutL OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mutL PE=3 SV=1 11 365 8.0E-48
sp|Q1C0Z8|MUTL_YERPA DNA mismatch repair protein MutL OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=mutL PE=3 SV=1 11 365 8.0E-48
sp|B3PRD9|MUTL_RHIE6 DNA mismatch repair protein MutL OS=Rhizobium etli (strain CIAT 652) GN=mutL PE=3 SV=1 12 371 8.0E-48
sp|A8AMN1|MUTL_CITK8 DNA mismatch repair protein MutL OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mutL PE=3 SV=1 11 367 9.0E-48
sp|Q83P35|MUTL_SHIFL DNA mismatch repair protein MutL OS=Shigella flexneri GN=mutL PE=3 SV=4 11 367 9.0E-48
sp|Q0SXB2|MUTL_SHIF8 DNA mismatch repair protein MutL OS=Shigella flexneri serotype 5b (strain 8401) GN=mutL PE=3 SV=1 11 367 9.0E-48
sp|Q5F8M6|MUTL_NEIG1 DNA mismatch repair protein MutL OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=mutL PE=1 SV=1 12 368 1.0E-47
sp|Q92RP4|MUTL_RHIME DNA mismatch repair protein MutL OS=Rhizobium meliloti (strain 1021) GN=mutL PE=3 SV=1 12 349 1.0E-47
sp|Q31TA0|MUTL_SHIBS DNA mismatch repair protein MutL OS=Shigella boydii serotype 4 (strain Sb227) GN=mutL PE=3 SV=1 11 367 1.0E-47
sp|B4T2R5|MUTL_SALNS DNA mismatch repair protein MutL OS=Salmonella newport (strain SL254) GN=mutL PE=3 SV=1 11 366 1.0E-47
sp|Q328E9|MUTL_SHIDS DNA mismatch repair protein MutL OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=mutL PE=3 SV=1 11 367 2.0E-47
sp|B5FBR6|MUTL_VIBFM DNA mismatch repair protein MutL OS=Vibrio fischeri (strain MJ11) GN=mutL PE=3 SV=1 11 626 2.0E-47
sp|Q1I447|MUTL_PSEE4 DNA mismatch repair protein MutL OS=Pseudomonas entomophila (strain L48) GN=mutL PE=3 SV=1 8 368 2.0E-47
sp|Q8UHI3|MUTL_AGRFC DNA mismatch repair protein MutL OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=mutL PE=3 SV=2 12 371 2.0E-47
sp|Q8FAK9|MUTL_ECOL6 DNA mismatch repair protein MutL OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mutL PE=3 SV=2 11 367 3.0E-47
sp|B1LQJ0|MUTL_ECOSM DNA mismatch repair protein MutL OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mutL PE=3 SV=1 11 367 3.0E-47
sp|B7MSY3|MUTL_ECO81 DNA mismatch repair protein MutL OS=Escherichia coli O81 (strain ED1a) GN=mutL PE=3 SV=1 11 367 3.0E-47
sp|Q0T9M3|MUTL_ECOL5 DNA mismatch repair protein MutL OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mutL PE=3 SV=1 11 367 3.0E-47
sp|A1AJ76|MUTL_ECOK1 DNA mismatch repair protein MutL OS=Escherichia coli O1:K1 / APEC GN=mutL PE=3 SV=1 11 367 3.0E-47
sp|B7MKX4|MUTL_ECO45 DNA mismatch repair protein MutL OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mutL PE=3 SV=1 11 367 3.0E-47
sp|B7UQH9|MUTL_ECO27 DNA mismatch repair protein MutL OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mutL PE=3 SV=1 11 367 3.0E-47
sp|C5BDM9|MUTL_EDWI9 DNA mismatch repair protein MutL OS=Edwardsiella ictaluri (strain 93-146) GN=mutL PE=3 SV=1 11 365 3.0E-47
sp|Q8XDN4|MUTL_ECO57 DNA mismatch repair protein MutL OS=Escherichia coli O157:H7 GN=mutL PE=3 SV=1 11 367 3.0E-47
sp|B5Z2H6|MUTL_ECO5E DNA mismatch repair protein MutL OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mutL PE=3 SV=1 11 367 3.0E-47
sp|C4ZA52|MUTL_EUBR3 DNA mismatch repair protein MutL OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=mutL PE=3 SV=1 12 368 4.0E-47
sp|A6U6K5|MUTL_SINMW DNA mismatch repair protein MutL OS=Sinorhizobium medicae (strain WSM419) GN=mutL PE=3 SV=1 12 384 4.0E-47
sp|B3E5Z2|MUTL_GEOLS DNA mismatch repair protein MutL OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=mutL PE=3 SV=1 12 367 4.0E-47
sp|P49850|MUTL_BACSU DNA mismatch repair protein MutL OS=Bacillus subtilis (strain 168) GN=mutL PE=1 SV=1 14 436 5.0E-47
sp|B1I293|MUTL_DESAP DNA mismatch repair protein MutL OS=Desulforudis audaxviator (strain MP104C) GN=mutL PE=3 SV=1 12 355 5.0E-47
sp|B2TIB8|MUTL_CLOBB DNA mismatch repair protein MutL OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=mutL PE=3 SV=1 10 359 5.0E-47
sp|B1IT36|MUTL_ECOLC DNA mismatch repair protein MutL OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mutL PE=3 SV=1 11 367 5.0E-47
sp|A4G289|MUTL_HERAR DNA mismatch repair protein MutL OS=Herminiimonas arsenicoxydans GN=mutL PE=3 SV=1 10 392 5.0E-47
sp|A1JIR3|MUTL_YERE8 DNA mismatch repair protein MutL OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mutL PE=3 SV=1 11 438 6.0E-47
sp|Q9HUL8|MUTL_PSEAE DNA mismatch repair protein MutL OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=mutL PE=3 SV=1 12 349 6.0E-47
sp|B7V209|MUTL_PSEA8 DNA mismatch repair protein MutL OS=Pseudomonas aeruginosa (strain LESB58) GN=mutL PE=3 SV=1 12 349 6.0E-47
sp|Q02F72|MUTL_PSEAB DNA mismatch repair protein MutL OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=mutL PE=3 SV=1 12 349 7.0E-47
sp|B1KHV0|MUTL_SHEWM DNA mismatch repair protein MutL OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=mutL PE=3 SV=1 12 367 8.0E-47
sp|A9N4Y4|MUTL_SALPB DNA mismatch repair protein MutL OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mutL PE=3 SV=1 11 366 8.0E-47
sp|B4TFA4|MUTL_SALHS DNA mismatch repair protein MutL OS=Salmonella heidelberg (strain SL476) GN=mutL PE=3 SV=1 11 366 8.0E-47
sp|B5R0N7|MUTL_SALEP DNA mismatch repair protein MutL OS=Salmonella enteritidis PT4 (strain P125109) GN=mutL PE=3 SV=1 11 366 9.0E-47
sp|B5FRM6|MUTL_SALDC DNA mismatch repair protein MutL OS=Salmonella dublin (strain CT_02021853) GN=mutL PE=3 SV=1 11 366 9.0E-47
sp|Q219I5|MUTL_RHOPB DNA mismatch repair protein MutL OS=Rhodopseudomonas palustris (strain BisB18) GN=mutL PE=3 SV=1 11 395 9.0E-47
sp|P14161|MUTL_SALTY DNA mismatch repair protein MutL OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mutL PE=3 SV=1 11 366 9.0E-47
sp|B5BKH9|MUTL_SALPK DNA mismatch repair protein MutL OS=Salmonella paratyphi A (strain AKU_12601) GN=mutL PE=3 SV=1 11 366 9.0E-47
sp|Q5PL49|MUTL_SALPA DNA mismatch repair protein MutL OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mutL PE=3 SV=1 11 366 9.0E-47
sp|B5R9B7|MUTL_SALG2 DNA mismatch repair protein MutL OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=mutL PE=3 SV=1 11 366 9.0E-47
sp|B4TSF0|MUTL_SALSV DNA mismatch repair protein MutL OS=Salmonella schwarzengrund (strain CVM19633) GN=mutL PE=3 SV=1 11 366 1.0E-46
sp|B5F385|MUTL_SALA4 DNA mismatch repair protein MutL OS=Salmonella agona (strain SL483) GN=mutL PE=3 SV=1 11 366 1.0E-46
sp|Q8Z187|MUTL_SALTI DNA mismatch repair protein MutL OS=Salmonella typhi GN=mutL PE=3 SV=1 11 366 1.0E-46
sp|C0Q6C7|MUTL_SALPC DNA mismatch repair protein MutL OS=Salmonella paratyphi C (strain RKS4594) GN=mutL PE=3 SV=1 11 366 1.0E-46
sp|Q57GM1|MUTL_SALCH DNA mismatch repair protein MutL OS=Salmonella choleraesuis (strain SC-B67) GN=mutL PE=3 SV=1 11 366 1.0E-46
sp|A9MFP2|MUTL_SALAR DNA mismatch repair protein MutL OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=mutL PE=3 SV=1 11 366 1.0E-46
sp|B6I274|MUTL_ECOSE DNA mismatch repair protein MutL OS=Escherichia coli (strain SE11) GN=mutL PE=3 SV=1 11 367 1.0E-46
sp|A8A7R4|MUTL_ECOHS DNA mismatch repair protein MutL OS=Escherichia coli O9:H4 (strain HS) GN=mutL PE=3 SV=1 11 367 1.0E-46
sp|A7ZV39|MUTL_ECO24 DNA mismatch repair protein MutL OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mutL PE=3 SV=1 11 367 1.0E-46
sp|B7M8T0|MUTL_ECO8A DNA mismatch repair protein MutL OS=Escherichia coli O8 (strain IAI1) GN=mutL PE=3 SV=1 11 367 1.0E-46
sp|Q3YUH3|MUTL_SHISS DNA mismatch repair protein MutL OS=Shigella sonnei (strain Ss046) GN=mutL PE=3 SV=1 11 367 1.0E-46
sp|B2TY45|MUTL_SHIB3 DNA mismatch repair protein MutL OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mutL PE=3 SV=1 11 367 1.0E-46
sp|P23367|MUTL_ECOLI DNA mismatch repair protein MutL OS=Escherichia coli (strain K12) GN=mutL PE=1 SV=2 11 367 1.0E-46
sp|B1XDS1|MUTL_ECODH DNA mismatch repair protein MutL OS=Escherichia coli (strain K12 / DH10B) GN=mutL PE=3 SV=1 11 367 1.0E-46
sp|C5A1G1|MUTL_ECOBW DNA mismatch repair protein MutL OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mutL PE=3 SV=1 11 367 1.0E-46
sp|A8G8U7|MUTL_SERP5 DNA mismatch repair protein MutL OS=Serratia proteamaculans (strain 568) GN=mutL PE=3 SV=1 11 450 1.0E-46
sp|Q5QW89|MUTL_IDILO DNA mismatch repair protein MutL OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=mutL PE=3 SV=1 12 379 1.0E-46
sp|Q1MKU7|MUTL_RHIL3 DNA mismatch repair protein MutL OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=mutL PE=3 SV=1 12 371 1.0E-46
sp|B4RA70|MUTL_PHEZH DNA mismatch repair protein MutL OS=Phenylobacterium zucineum (strain HLK1) GN=mutL PE=3 SV=1 11 372 1.0E-46
sp|A6VD59|MUTL_PSEA7 DNA mismatch repair protein MutL OS=Pseudomonas aeruginosa (strain PA7) GN=mutL PE=3 SV=1 12 349 1.0E-46
sp|A1SZL2|MUTL_PSYIN DNA mismatch repair protein MutL OS=Psychromonas ingrahamii (strain 37) GN=mutL PE=3 SV=1 11 349 1.0E-46
sp|Q035Z3|MUTL_LACC3 DNA mismatch repair protein MutL OS=Lactobacillus casei (strain ATCC 334) GN=mutL PE=3 SV=1 9 368 1.0E-46
sp|B7NGA4|MUTL_ECOLU DNA mismatch repair protein MutL OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mutL PE=3 SV=1 11 367 2.0E-46
sp|P57886|MUTL_PASMU DNA mismatch repair protein MutL OS=Pasteurella multocida (strain Pm70) GN=mutL PE=3 SV=1 12 359 2.0E-46
sp|Q12J93|MUTL_SHEDO DNA mismatch repair protein MutL OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=mutL PE=3 SV=1 11 409 2.0E-46
sp|Q2ISE2|MUTL_RHOP2 DNA mismatch repair protein MutL OS=Rhodopseudomonas palustris (strain HaA2) GN=mutL PE=3 SV=1 11 395 2.0E-46
sp|Q1RGP6|MUTL_RICBR DNA mismatch repair protein MutL OS=Rickettsia bellii (strain RML369-C) GN=mutL PE=3 SV=1 12 349 2.0E-46
sp|B7LLV2|MUTL_ESCF3 DNA mismatch repair protein MutL OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mutL PE=3 SV=1 11 367 2.0E-46
sp|B5EGD4|MUTL_GEOBB DNA mismatch repair protein MutL OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=mutL PE=3 SV=1 12 367 2.0E-46
sp|B3QW86|MUTL_CHLT3 DNA mismatch repair protein MutL OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=mutL PE=3 SV=1 12 367 3.0E-46
sp|Q7MYT9|MUTL_PHOLL DNA mismatch repair protein MutL OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=mutL PE=3 SV=1 12 349 3.0E-46
sp|B7LC24|MUTL_ECO55 DNA mismatch repair protein MutL OS=Escherichia coli (strain 55989 / EAEC) GN=mutL PE=3 SV=1 11 367 3.0E-46
sp|Q3SPJ0|MUTL_NITWN DNA mismatch repair protein MutL OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=mutL PE=3 SV=1 11 423 4.0E-46
sp|Q7WG61|MUTL_BORBR DNA mismatch repair protein MutL OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=mutL PE=3 SV=1 10 373 4.0E-46
sp|Q2KBX7|MUTL_RHIEC DNA mismatch repair protein MutL OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=mutL PE=3 SV=1 12 371 4.0E-46
sp|C3KDW1|MUTL_PSEFS DNA mismatch repair protein MutL OS=Pseudomonas fluorescens (strain SBW25) GN=mutL PE=3 SV=1 12 349 4.0E-46
sp|B8E280|MUTL_DICTD DNA mismatch repair protein MutL OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=mutL PE=3 SV=1 15 376 5.0E-46
sp|Q131I8|MUTL_RHOPS DNA mismatch repair protein MutL OS=Rhodopseudomonas palustris (strain BisB5) GN=mutL PE=3 SV=1 11 395 5.0E-46
sp|B1IM67|MUTL_CLOBK DNA mismatch repair protein MutL OS=Clostridium botulinum (strain Okra / Type B1) GN=mutL PE=3 SV=1 10 372 5.0E-46
sp|Q7W4N5|MUTL_BORPA DNA mismatch repair protein MutL OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=mutL PE=3 SV=1 10 373 5.0E-46
sp|A6VN10|MUTL_ACTSZ DNA mismatch repair protein MutL OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=mutL PE=3 SV=1 11 349 5.0E-46
sp|B8ETE4|MUTL_METSB DNA mismatch repair protein MutL OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=mutL PE=3 SV=1 11 349 5.0E-46
sp|A7MMA2|MUTL_CROS8 DNA mismatch repair protein MutL OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=mutL PE=3 SV=1 11 368 6.0E-46
sp|B2VCU8|MUTL_ERWT9 DNA mismatch repair protein MutL OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=mutL PE=3 SV=1 12 349 6.0E-46
sp|B1JAD6|MUTL_PSEPW DNA mismatch repair protein MutL OS=Pseudomonas putida (strain W619) GN=mutL PE=3 SV=1 8 368 6.0E-46
sp|B3W9W3|MUTL_LACCB DNA mismatch repair protein MutL OS=Lactobacillus casei (strain BL23) GN=mutL PE=3 SV=1 9 368 6.0E-46
sp|B0KKZ7|MUTL_PSEPG DNA mismatch repair protein MutL OS=Pseudomonas putida (strain GB-1) GN=mutL PE=3 SV=1 8 427 7.0E-46
sp|Q88DD1|MUTL_PSEPK DNA mismatch repair protein MutL OS=Pseudomonas putida (strain KT2440) GN=mutL PE=3 SV=1 8 427 7.0E-46
sp|Q4UJQ1|MUTL_RICFE DNA mismatch repair protein MutL OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=mutL PE=3 SV=1 12 349 7.0E-46
sp|B5ZS00|MUTL_RHILW DNA mismatch repair protein MutL OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=mutL PE=3 SV=1 12 371 8.0E-46
sp|C6E4L2|MUTL_GEOSM DNA mismatch repair protein MutL OS=Geobacter sp. (strain M21) GN=mutL PE=3 SV=1 12 367 8.0E-46
sp|A0LZH8|MUTL_GRAFK DNA mismatch repair protein MutL OS=Gramella forsetii (strain KT0803) GN=mutL PE=3 SV=1 12 349 8.0E-46
sp|B0TU66|MUTL_SHEHH DNA mismatch repair protein MutL OS=Shewanella halifaxensis (strain HAW-EB4) GN=mutL PE=3 SV=1 12 349 8.0E-46
sp|Q0HR40|MUTL_SHESR DNA mismatch repair protein MutL OS=Shewanella sp. (strain MR-7) GN=mutL PE=3 SV=1 12 377 8.0E-46
sp|B0SWX9|MUTL_CAUSK DNA mismatch repair protein MutL OS=Caulobacter sp. (strain K31) GN=mutL PE=3 SV=1 11 372 1.0E-45
sp|A0KSR5|MUTL_SHESA DNA mismatch repair protein MutL OS=Shewanella sp. (strain ANA-3) GN=mutL PE=3 SV=1 12 377 1.0E-45
sp|Q0HMP1|MUTL_SHESM DNA mismatch repair protein MutL OS=Shewanella sp. (strain MR-4) GN=mutL PE=3 SV=1 12 372 1.0E-45
sp|A7FUK9|MUTL_CLOB1 DNA mismatch repair protein MutL OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=mutL PE=3 SV=1 10 372 1.0E-45
sp|B1KSA2|MUTL_CLOBM DNA mismatch repair protein MutL OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=mutL PE=3 SV=1 10 372 1.0E-45
sp|B3Q7Y9|MUTL_RHOPT DNA mismatch repair protein MutL OS=Rhodopseudomonas palustris (strain TIE-1) GN=mutL PE=3 SV=1 11 395 1.0E-45
sp|Q87VJ2|MUTL_PSESM DNA mismatch repair protein MutL OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=mutL PE=3 SV=1 12 349 1.0E-45
sp|Q6N1N4|MUTL_RHOPA DNA mismatch repair protein MutL OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=mutL PE=3 SV=1 11 372 1.0E-45
sp|A8H8G8|MUTL_SHEPA DNA mismatch repair protein MutL OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=mutL PE=3 SV=1 12 390 1.0E-45
sp|C0RKF6|MUTL_BRUMB DNA mismatch repair protein MutL OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=mutL PE=3 SV=1 12 371 2.0E-45
sp|P65490|MUTL_BRUSU DNA mismatch repair protein MutL OS=Brucella suis biovar 1 (strain 1330) GN=mutL PE=3 SV=1 12 371 2.0E-45
sp|A5VTW1|MUTL_BRUO2 DNA mismatch repair protein MutL OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=mutL PE=3 SV=1 12 371 2.0E-45
sp|P65489|MUTL_BRUME DNA mismatch repair protein MutL OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=mutL PE=3 SV=1 12 371 2.0E-45
sp|Q579M7|MUTL_BRUAB DNA mismatch repair protein MutL OS=Brucella abortus biovar 1 (strain 9-941) GN=mutL PE=3 SV=1 12 371 2.0E-45
sp|Q2YIH2|MUTL_BRUA2 DNA mismatch repair protein MutL OS=Brucella abortus (strain 2308) GN=mutL PE=3 SV=1 12 371 2.0E-45
sp|B2SD15|MUTL_BRUA1 DNA mismatch repair protein MutL OS=Brucella abortus (strain S19) GN=mutL PE=3 SV=1 12 371 2.0E-45
sp|B9K7B8|MUTL_THENN DNA mismatch repair protein MutL OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=mutL PE=3 SV=1 12 393 2.0E-45
sp|A9MDX3|MUTL_BRUC2 DNA mismatch repair protein MutL OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=mutL PE=3 SV=1 12 371 2.0E-45
sp|B8CIX3|MUTL_SHEPW DNA mismatch repair protein MutL OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=mutL PE=3 SV=1 12 368 2.0E-45
sp|A4SR27|MUTL_AERS4 DNA mismatch repair protein MutL OS=Aeromonas salmonicida (strain A449) GN=mutL PE=3 SV=1 11 349 2.0E-45
sp|A8GQA9|MUTL_RICAH DNA mismatch repair protein MutL OS=Rickettsia akari (strain Hartford) GN=mutL PE=3 SV=1 12 349 2.0E-45
sp|A9WXS2|MUTL_BRUSI DNA mismatch repair protein MutL OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=mutL PE=3 SV=1 12 371 2.0E-45
sp|Q8EJ70|MUTL_SHEON DNA mismatch repair protein MutL OS=Shewanella oneidensis (strain MR-1) GN=mutL PE=3 SV=1 12 374 2.0E-45
sp|B3EHI9|MUTL_CHLL2 DNA mismatch repair protein MutL OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=mutL PE=3 SV=1 12 370 2.0E-45
sp|Q1QIP3|MUTL_NITHX DNA mismatch repair protein MutL OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=mutL PE=3 SV=1 11 372 3.0E-45
sp|A7GE44|MUTL_CLOBL DNA mismatch repair protein MutL OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=mutL PE=3 SV=1 10 372 3.0E-45
sp|Q5GZ85|MUTL_XANOR DNA mismatch repair protein MutL OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=mutL PE=3 SV=1 12 368 3.0E-45
sp|B2SHP8|MUTL_XANOP DNA mismatch repair protein MutL OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=mutL PE=3 SV=1 12 368 3.0E-45
sp|Q2P295|MUTL_XANOM DNA mismatch repair protein MutL OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=mutL PE=3 SV=1 12 368 3.0E-45
sp|Q07XW5|MUTL_SHEFN DNA mismatch repair protein MutL OS=Shewanella frigidimarina (strain NCIMB 400) GN=mutL PE=3 SV=1 12 349 3.0E-45
sp|Q8PJX2|MUTL_XANAC DNA mismatch repair protein MutL OS=Xanthomonas axonopodis pv. citri (strain 306) GN=mutL PE=3 SV=1 12 368 4.0E-45
sp|Q1LSQ2|MUTL_BAUCH DNA mismatch repair protein MutL OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=mutL PE=3 SV=1 12 369 5.0E-45
sp|A8GY89|MUTL_RICB8 DNA mismatch repair protein MutL OS=Rickettsia bellii (strain OSU 85-389) GN=mutL PE=3 SV=1 12 349 5.0E-45
sp|Q97I20|MUTL_CLOAB DNA mismatch repair protein MutL OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=mutL PE=3 SV=1 21 442 5.0E-45
sp|B5Y334|MUTL_KLEP3 DNA mismatch repair protein MutL OS=Klebsiella pneumoniae (strain 342) GN=mutL PE=3 SV=1 11 367 6.0E-45
sp|Q3BSD0|MUTL_XANC5 DNA mismatch repair protein MutL OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=mutL PE=3 SV=1 12 368 6.0E-45
sp|C1FNT8|MUTL_CLOBJ DNA mismatch repair protein MutL OS=Clostridium botulinum (strain Kyoto / Type A2) GN=mutL PE=3 SV=1 10 372 6.0E-45
sp|Q3A504|MUTL_PELCD DNA mismatch repair protein MutL OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=mutL PE=3 SV=1 12 365 6.0E-45
sp|Q8XWB1|MUTL_RALSO DNA mismatch repair protein MutL OS=Ralstonia solanacearum (strain GMI1000) GN=mutL PE=3 SV=1 10 368 7.0E-45
sp|B2ULE2|MUTL_AKKM8 DNA mismatch repair protein MutL OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=mutL PE=3 SV=1 12 370 8.0E-45
sp|Q5E2C6|MUTL_VIBF1 DNA mismatch repair protein MutL OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=mutL PE=3 SV=1 11 349 8.0E-45
sp|B1N024|MUTL_LEUCK DNA mismatch repair protein MutL OS=Leuconostoc citreum (strain KM20) GN=mutL PE=3 SV=1 12 368 8.0E-45
sp|C3PM22|MUTL_RICAE DNA mismatch repair protein MutL OS=Rickettsia africae (strain ESF-5) GN=mutL PE=3 SV=1 12 349 9.0E-45
sp|A6TH85|MUTL_KLEP7 DNA mismatch repair protein MutL OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mutL PE=3 SV=1 11 367 1.0E-44
sp|Q07RR2|MUTL_RHOP5 DNA mismatch repair protein MutL OS=Rhodopseudomonas palustris (strain BisA53) GN=mutL PE=3 SV=1 11 372 1.0E-44
sp|Q8P8E4|MUTL_XANCP DNA mismatch repair protein MutL OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=mutL PE=3 SV=1 12 368 1.0E-44
sp|B0RRZ8|MUTL_XANCB DNA mismatch repair protein MutL OS=Xanthomonas campestris pv. campestris (strain B100) GN=mutL PE=3 SV=1 12 368 1.0E-44
sp|Q4UVP3|MUTL_XANC8 DNA mismatch repair protein MutL OS=Xanthomonas campestris pv. campestris (strain 8004) GN=mutL PE=3 SV=1 12 368 1.0E-44
sp|A3QAD8|MUTL_SHELP DNA mismatch repair protein MutL OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=mutL PE=3 SV=1 12 349 1.0E-44
sp|B6EMQ9|MUTL_ALISL DNA mismatch repair protein MutL OS=Aliivibrio salmonicida (strain LFI1238) GN=mutL PE=3 SV=1 11 349 1.0E-44
sp|A8F0A4|MUTL_RICCK DNA mismatch repair protein MutL OS=Rickettsia canadensis (strain McKiel) GN=mutL PE=3 SV=1 12 349 1.0E-44
sp|A0KGR9|MUTL_AERHH DNA mismatch repair protein MutL OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=mutL PE=3 SV=1 11 349 1.0E-44
sp|Q92FW6|MUTL_RICCN DNA mismatch repair protein MutL OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=mutL PE=3 SV=1 12 349 2.0E-44
sp|B1ZZY2|MUTL_OPITP DNA mismatch repair protein MutL OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=mutL PE=3 SV=1 12 367 2.0E-44
sp|Q1GSN3|MUTL_SPHAL DNA mismatch repair protein MutL OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=mutL PE=3 SV=1 12 349 2.0E-44
sp|B9M3N0|MUTL_GEODF DNA mismatch repair protein MutL OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=mutL PE=3 SV=1 12 367 2.0E-44
sp|A8FRD3|MUTL_SHESH DNA mismatch repair protein MutL OS=Shewanella sediminis (strain HAW-EB3) GN=mutL PE=3 SV=1 12 372 3.0E-44
sp|C4L9N1|MUTL_TOLAT DNA mismatch repair protein MutL OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=mutL PE=3 SV=1 11 367 3.0E-44
sp|A1BCW2|MUTL_CHLPD DNA mismatch repair protein MutL OS=Chlorobium phaeobacteroides (strain DSM 266) GN=mutL PE=3 SV=1 12 370 3.0E-44
sp|A0Q0M7|MUTL_CLONN DNA mismatch repair protein MutL OS=Clostridium novyi (strain NT) GN=mutL PE=3 SV=1 10 442 3.0E-44
sp|A0LJK2|MUTL_SYNFM DNA mismatch repair protein MutL OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=mutL PE=3 SV=1 15 349 3.0E-44
sp|Q895H3|MUTL_CLOTE DNA mismatch repair protein MutL OS=Clostridium tetani (strain Massachusetts / E88) GN=mutL PE=3 SV=1 10 356 3.0E-44
sp|A5EXM6|MUTL_DICNV DNA mismatch repair protein MutL OS=Dichelobacter nodosus (strain VCS1703A) GN=mutL PE=3 SV=1 15 349 3.0E-44
sp|Q6D065|MUTL_PECAS DNA mismatch repair protein MutL OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mutL PE=3 SV=1 11 368 3.0E-44
sp|C6DFJ9|MUTL_PECCP DNA mismatch repair protein MutL OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mutL PE=3 SV=1 11 368 4.0E-44
sp|B0ST13|MUTL_LEPBP DNA mismatch repair protein MutL OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=mutL PE=3 SV=1 12 356 4.0E-44
sp|B0SB85|MUTL_LEPBA DNA mismatch repair protein MutL OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=mutL PE=3 SV=1 12 356 4.0E-44
sp|Q983L2|MUTL_RHILO DNA mismatch repair protein MutL OS=Rhizobium loti (strain MAFF303099) GN=mutL PE=3 SV=1 11 371 4.0E-44
sp|A1SA23|MUTL_SHEAM DNA mismatch repair protein MutL OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=mutL PE=3 SV=1 12 368 4.0E-44
sp|A9IN82|MUTL_BART1 DNA mismatch repair protein MutL OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=mutL PE=3 SV=1 12 349 4.0E-44
sp|Q9ZC88|MUTL_RICPR DNA mismatch repair protein MutL OS=Rickettsia prowazekii (strain Madrid E) GN=mutL PE=3 SV=1 12 349 5.0E-44
sp|Q0AYB2|MUTL_SYNWW DNA mismatch repair protein MutL OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=mutL PE=3 SV=1 12 405 6.0E-44
sp|C3LR77|MUTL_VIBCM DNA mismatch repair protein MutL OS=Vibrio cholerae serotype O1 (strain M66-2) GN=mutL PE=3 SV=1 12 349 7.0E-44
sp|Q9KV13|MUTL_VIBCH DNA mismatch repair protein MutL OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=mutL PE=3 SV=1 12 349 7.0E-44
sp|A5F3L5|MUTL_VIBC3 DNA mismatch repair protein MutL OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=mutL PE=3 SV=1 12 349 7.0E-44
sp|Q68VN4|MUTL_RICTY DNA mismatch repair protein MutL OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=mutL PE=3 SV=1 12 349 8.0E-44
sp|A5FNH2|MUTL_FLAJ1 DNA mismatch repair protein MutL OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=mutL PE=3 SV=1 12 355 9.0E-44
sp|Q7W0A6|MUTL_BORPE DNA mismatch repair protein MutL OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=mutL PE=3 SV=1 10 373 1.0E-43
sp|Q2LUR5|MUTL_SYNAS DNA mismatch repair protein MutL OS=Syntrophus aciditrophicus (strain SB) GN=mutL PE=3 SV=1 15 373 1.0E-43
sp|Q2RQ52|MUTL_RHORT DNA mismatch repair protein MutL OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=mutL PE=3 SV=1 12 372 1.0E-43
sp|A6WSV4|MUTL_SHEB8 DNA mismatch repair protein MutL OS=Shewanella baltica (strain OS185) GN=mutL PE=3 SV=1 12 372 2.0E-43
sp|Q3ACA6|MUTL_CARHZ DNA mismatch repair protein MutL OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=mutL PE=3 SV=1 9 368 2.0E-43
sp|A5GEV5|MUTL_GEOUR DNA mismatch repair protein MutL OS=Geobacter uraniireducens (strain Rf4) GN=mutL PE=3 SV=1 12 367 3.0E-43
sp|A3D022|MUTL_SHEB5 DNA mismatch repair protein MutL OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=mutL PE=3 SV=1 12 372 3.0E-43
sp|A6LWJ1|MUTL_CLOB8 DNA mismatch repair protein MutL OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=mutL PE=3 SV=1 10 359 3.0E-43
sp|Q1D568|MUTL_MYXXD DNA mismatch repair protein MutL OS=Myxococcus xanthus (strain DK 1622) GN=mutL PE=3 SV=1 12 367 4.0E-43
sp|B2KB18|MUTL_ELUMP DNA mismatch repair protein MutL OS=Elusimicrobium minutum (strain Pei191) GN=mutL PE=3 SV=1 12 372 5.0E-43
sp|Q941I6|PMS1_ARATH DNA mismatch repair protein PMS1 OS=Arabidopsis thaliana GN=PMS1 PE=1 SV=1 12 355 6.0E-43
sp|A8GU58|MUTL_RICRS DNA mismatch repair protein MutL OS=Rickettsia rickettsii (strain Sheila Smith) GN=mutL PE=3 SV=1 12 349 7.0E-43
sp|Q7MH01|MUTL_VIBVY DNA mismatch repair protein MutL OS=Vibrio vulnificus (strain YJ016) GN=mutL PE=3 SV=1 12 447 8.0E-43
sp|A8F560|MUTL_PSELT DNA mismatch repair protein MutL OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=mutL PE=3 SV=1 12 369 8.0E-43
sp|B0BVP7|MUTL_RICRO DNA mismatch repair protein MutL OS=Rickettsia rickettsii (strain Iowa) GN=mutL PE=3 SV=1 12 349 8.0E-43
sp|Q8DCV0|MUTL_VIBVU DNA mismatch repair protein MutL OS=Vibrio vulnificus (strain CMCP6) GN=mutL PE=3 SV=1 12 349 9.0E-43
sp|A9L3W1|MUTL_SHEB9 DNA mismatch repair protein MutL OS=Shewanella baltica (strain OS195) GN=mutL PE=3 SV=1 12 372 1.0E-42
sp|Q11L80|MUTL_CHESB DNA mismatch repair protein MutL OS=Chelativorans sp. (strain BNC1) GN=mutL PE=3 SV=1 11 371 1.0E-42
sp|Q6G0J4|MUTL_BARQU DNA mismatch repair protein MutL OS=Bartonella quintana (strain Toulouse) GN=mutL PE=3 SV=1 12 349 1.0E-42
sp|B8D891|MUTL_BUCAT DNA mismatch repair protein MutL OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=mutL PE=3 SV=1 11 349 2.0E-42
sp|P57633|MUTL_BUCAI DNA mismatch repair protein MutL OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mutL PE=3 SV=1 11 349 2.0E-42
sp|B8D8D4|MUTL_BUCA5 DNA mismatch repair protein MutL OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=mutL PE=3 SV=1 11 349 2.0E-42
sp|Q6G4R4|MUTL_BARHE DNA mismatch repair protein MutL OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=mutL PE=3 SV=1 12 446 2.0E-42
sp|P38920|MLH1_YEAST DNA mismatch repair protein MLH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MLH1 PE=1 SV=2 455 734 3.0E-42
sp|P0CAV5|MUTL_CAUCR DNA mismatch repair protein MutL OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=mutL PE=3 SV=1 11 381 3.0E-42
sp|B8H173|MUTL_CAUCN DNA mismatch repair protein MutL OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=mutL PE=3 SV=1 11 381 3.0E-42
sp|Q87L05|MUTL_VIBPA DNA mismatch repair protein MutL OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=mutL PE=3 SV=1 12 442 4.0E-42
sp|A7HC45|MUTL_ANADF DNA mismatch repair protein MutL OS=Anaeromyxobacter sp. (strain Fw109-5) GN=mutL PE=3 SV=1 12 355 4.0E-42
sp|C4K2Y5|MUTL_RICPU DNA mismatch repair protein MutL OS=Rickettsia peacockii (strain Rustic) GN=mutL PE=3 SV=1 12 349 5.0E-42
sp|Q5GSP0|MUTL_WOLTR DNA mismatch repair protein MutL OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=mutL PE=3 SV=1 15 395 5.0E-42
sp|A2SSN1|MUTL_METLZ DNA mismatch repair protein MutL OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=mutL PE=3 SV=1 12 367 5.0E-42
sp|C1A8L2|MUTL_GEMAT DNA mismatch repair protein MutL OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=mutL PE=3 SV=1 15 384 8.0E-42
sp|Q8XL86|MUTL_CLOPE DNA mismatch repair protein MutL OS=Clostridium perfringens (strain 13 / Type A) GN=mutL PE=3 SV=1 21 361 8.0E-42
sp|Q3SIQ5|MUTL_THIDA DNA mismatch repair protein MutL OS=Thiobacillus denitrificans (strain ATCC 25259) GN=mutL PE=3 SV=1 12 349 9.0E-42
sp|Q2GJE2|MUTL_ANAPZ DNA mismatch repair protein MutL OS=Anaplasma phagocytophilum (strain HZ) GN=mutL PE=3 SV=1 11 368 1.0E-41
sp|A3CWX7|MUTL_METMJ DNA mismatch repair protein MutL OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=mutL PE=3 SV=1 12 368 2.0E-41
sp|Q64NX1|MUTL_BACFR DNA mismatch repair protein MutL OS=Bacteroides fragilis (strain YCH46) GN=mutL PE=3 SV=1 12 368 2.0E-41
sp|Q5L8M5|MUTL_BACFN DNA mismatch repair protein MutL OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=mutL PE=3 SV=1 12 368 2.0E-41
sp|Q88UZ8|MUTL_LACPL DNA mismatch repair protein MutL OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=mutL PE=3 SV=1 12 367 3.0E-41
sp|Q0TRD5|MUTL_CLOP1 DNA mismatch repair protein MutL OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=mutL PE=3 SV=1 21 361 3.0E-41
sp|Q0STR3|MUTL_CLOPS DNA mismatch repair protein MutL OS=Clostridium perfringens (strain SM101 / Type A) GN=mutL PE=3 SV=1 21 361 3.0E-41
sp|Q8A120|MUTL_BACTN DNA mismatch repair protein MutL OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=mutL PE=3 SV=1 12 368 3.0E-41
sp|B8J9F5|MUTL_ANAD2 DNA mismatch repair protein MutL OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=mutL PE=3 SV=1 12 355 5.0E-41
sp|A7HNR3|MUTL_FERNB DNA mismatch repair protein MutL OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=mutL PE=3 SV=1 12 349 5.0E-41
sp|Q2GDF7|MUTL_NEOSM DNA mismatch repair protein MutL OS=Neorickettsia sennetsu (strain Miyayama) GN=mutL PE=3 SV=1 19 349 6.0E-41
sp|C0R515|MUTL_WOLWR DNA mismatch repair protein MutL OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=mutL PE=3 SV=1 15 357 7.0E-41
sp|A6GYR1|MUTL_FLAPJ DNA mismatch repair protein MutL OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=mutL PE=3 SV=1 12 368 8.0E-41
sp|P54278|PMS2_HUMAN Mismatch repair endonuclease PMS2 OS=Homo sapiens GN=PMS2 PE=1 SV=2 10 355 9.0E-41
sp|P74925|MUTL_THEMA DNA mismatch repair protein MutL OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=mutL PE=3 SV=1 12 368 1.0E-40
sp|B4UCW3|MUTL_ANASK DNA mismatch repair protein MutL OS=Anaeromyxobacter sp. (strain K) GN=mutL PE=3 SV=1 12 355 2.0E-40
sp|Q9PFB8|MUTL_XYLFA DNA mismatch repair protein MutL OS=Xylella fastidiosa (strain 9a5c) GN=mutL PE=3 SV=1 11 368 3.0E-40
sp|B0U5C6|MUTL_XYLFM DNA mismatch repair protein MutL OS=Xylella fastidiosa (strain M12) GN=mutL PE=3 SV=1 11 368 3.0E-40
sp|Q2IIL0|MUTL_ANADE DNA mismatch repair protein MutL OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=mutL PE=3 SV=1 12 355 3.0E-40
sp|Q87AC9|MUTL_XYLFT DNA mismatch repair protein MutL OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=mutL PE=3 SV=1 11 368 5.0E-40
sp|B2I9E6|MUTL_XYLF2 DNA mismatch repair protein MutL OS=Xylella fastidiosa (strain M23) GN=mutL PE=3 SV=1 11 368 5.0E-40
sp|Q9HSM6|MUTL_HALSA DNA mismatch repair protein MutL OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=mutL PE=3 SV=1 12 355 5.0E-40
sp|B0R2S6|MUTL_HALS3 DNA mismatch repair protein MutL OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=mutL PE=3 SV=1 12 355 5.0E-40
sp|B2II71|MUTL_BEII9 DNA mismatch repair protein MutL OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=mutL PE=3 SV=1 12 349 6.0E-40
sp|A6KXH3|MUTL_BACV8 DNA mismatch repair protein MutL OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=mutL PE=3 SV=1 12 368 8.0E-40
sp|A1UU01|MUTL_BARBK DNA mismatch repair protein MutL OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=mutL PE=3 SV=1 12 349 9.0E-40
sp|B5YIZ6|MUTL_THEYD DNA mismatch repair protein MutL OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=mutL PE=3 SV=1 12 349 4.0E-39
sp|Q54KD8|MLH1_DICDI DNA mismatch repair protein Mlh1 OS=Dictyostelium discoideum GN=mlh1 PE=3 SV=1 484 734 2.0E-38
sp|P54279|PMS2_MOUSE Mismatch repair endonuclease PMS2 OS=Mus musculus GN=Pms2 PE=2 SV=1 10 355 2.0E-38
sp|A1QZ05|MUTL_BORT9 DNA mismatch repair protein MutL OS=Borrelia turicatae (strain 91E135) GN=mutL PE=3 SV=1 12 350 3.0E-38
sp|A5V3J3|MUTL_SPHWW DNA mismatch repair protein MutL OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=mutL PE=3 SV=1 12 349 5.0E-38
sp|B7JY11|MUTL_CYAP8 DNA mismatch repair protein MutL OS=Cyanothece sp. (strain PCC 8801) GN=mutL PE=3 SV=1 11 373 2.0E-37
sp|C0QSY6|MUTL_PERMH DNA mismatch repair protein MutL OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=mutL PE=3 SV=1 12 349 3.0E-37
sp|A6LL30|MUTL_THEM4 DNA mismatch repair protein MutL OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=mutL PE=3 SV=1 12 349 4.0E-37
sp|Q662F3|MUTL_BORBP DNA mismatch repair protein MutL OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=mutL PE=3 SV=1 12 361 5.0E-37
sp|O83325|MUTL_TREPA DNA mismatch repair protein MutL OS=Treponema pallidum (strain Nichols) GN=mutL PE=3 SV=2 10 360 7.0E-37
sp|B5RL36|MUTL_BORDL DNA mismatch repair protein MutL OS=Borrelia duttonii (strain Ly) GN=mutL PE=3 SV=1 12 350 1.0E-36
sp|Q0SNV1|MUTL_BORAP DNA mismatch repair protein MutL OS=Borrelia afzelii (strain PKo) GN=mutL PE=3 SV=1 12 361 1.0E-36
sp|Q9Z794|MUTL_CHLPN DNA mismatch repair protein MutL OS=Chlamydia pneumoniae GN=mutL PE=3 SV=1 10 368 1.0E-36
sp|O51229|MUTL_BORBU DNA mismatch repair protein MutL OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=mutL PE=3 SV=1 12 361 1.0E-36
sp|P14242|PMS1_YEAST DNA mismatch repair protein PMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMS1 PE=1 SV=3 12 369 2.0E-36
sp|P70754|MUTL_AQUPY DNA mismatch repair protein MutL OS=Aquifex pyrophilus GN=mutL PE=3 SV=1 22 366 2.0E-36
sp|P73349|MUTL_SYNY3 DNA mismatch repair protein MutL OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=mutL PE=3 SV=2 12 384 3.0E-36
sp|C5CF28|MUTL_KOSOT DNA mismatch repair protein MutL OS=Kosmotoga olearia (strain TBF 19.5.1) GN=mutL PE=3 SV=1 12 373 4.0E-36
sp|B5RR29|MUTL_BORRA DNA mismatch repair protein MutL OS=Borrelia recurrentis (strain A1) GN=mutL PE=3 SV=1 12 350 4.0E-36
sp|B7IHA2|MUTL_THEAB DNA mismatch repair protein MutL OS=Thermosipho africanus (strain TCF52B) GN=mutL PE=3 SV=1 12 349 1.0E-35
sp|Q9PJG5|MUTL_CHLMU DNA mismatch repair protein MutL OS=Chlamydia muridarum (strain MoPn / Nigg) GN=mutL PE=3 SV=1 12 362 4.0E-35
sp|O67518|MUTL_AQUAE DNA mismatch repair protein MutL OS=Aquifex aeolicus (strain VF5) GN=mutL PE=3 SV=1 23 363 3.0E-34
sp|O84579|MUTL_CHLTR DNA mismatch repair protein MutL OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=mutL PE=3 SV=1 9 367 8.0E-34
sp|Q3KLC2|MUTL_CHLTA DNA mismatch repair protein MutL OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=mutL PE=3 SV=1 9 367 8.0E-34
sp|Q5L4T7|MUTL_CHLAB DNA mismatch repair protein MutL OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=mutL PE=3 SV=1 12 381 2.0E-33
sp|Q8K913|MUTL_BUCAP DNA mismatch repair protein MutL OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mutL PE=3 SV=1 10 355 3.0E-33
sp|B0JS91|MUTL_MICAN DNA mismatch repair protein MutL OS=Microcystis aeruginosa (strain NIES-843) GN=mutL PE=3 SV=1 11 349 5.0E-33
sp|Q2GFV4|MUTL_EHRCR DNA mismatch repair protein MutL OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=mutL PE=3 SV=1 20 204 6.0E-33
sp|B1X109|MUTL_CYAA5 DNA mismatch repair protein MutL OS=Cyanothece sp. (strain ATCC 51142) GN=mutL PE=3 SV=1 11 405 1.0E-32
sp|A9BJB9|MUTL_PETMO DNA mismatch repair protein MutL OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=mutL PE=3 SV=1 12 367 2.0E-32
sp|Q3MEV6|MUTL_ANAVT DNA mismatch repair protein MutL OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=mutL PE=3 SV=1 12 360 2.0E-31
sp|Q821I9|MUTL_CHLCV DNA mismatch repair protein MutL OS=Chlamydophila caviae (strain GPIC) GN=mutL PE=3 SV=1 11 384 2.0E-31
sp|Q54QA0|PMS1_DICDI Mismatch repair endonuclease pms1 OS=Dictyostelium discoideum GN=pms1 PE=3 SV=1 12 241 1.0E-30
sp|P54280|PMS1_SCHPO DNA mismatch repair protein pms1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pms1 PE=3 SV=1 12 365 2.0E-30
sp|Q89A38|MUTL_BUCBP DNA mismatch repair protein MutL OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mutL PE=3 SV=1 23 342 2.0E-30
sp|Q9RTR0|MUTL_DEIRA DNA mismatch repair protein MutL OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=mutL PE=3 SV=1 9 368 1.0E-29
sp|Q8YSM9|MUTL_NOSS1 DNA mismatch repair protein MutL OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=mutL PE=3 SV=1 12 360 3.0E-29
sp|B2IYW1|MUTL_NOSP7 DNA mismatch repair protein MutL OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=mutL PE=3 SV=1 12 369 3.0E-29
sp|B0BA28|MUTL_CHLTB DNA mismatch repair protein MutL OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=mutL PE=3 SV=1 9 179 2.0E-25
sp|B0B8E9|MUTL_CHLT2 DNA mismatch repair protein MutL OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=mutL PE=3 SV=1 9 179 2.0E-25
sp|P54277|PMS1_HUMAN PMS1 protein homolog 1 OS=Homo sapiens GN=PMS1 PE=1 SV=1 12 355 7.0E-25
sp|Q256F3|MUTL_CHLFF DNA mismatch repair protein MutL OS=Chlamydophila felis (strain Fe/C-56) GN=mutL PE=3 SV=1 12 173 4.0E-24
sp|Q9RA54|MUTL_THET8 DNA mismatch repair protein MutL OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=mutL PE=3 SV=2 12 240 3.0E-23
sp|Q72J22|MUTL_THET2 DNA mismatch repair protein MutL OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=mutL PE=3 SV=1 12 240 3.0E-23
sp|P96082|MUTL_THEAQ DNA mismatch repair protein MutL OS=Thermus aquaticus GN=mutL PE=3 SV=1 12 351 1.0E-22
sp|O95744|PM2P2_HUMAN Putative postmeiotic segregation increased 2-like protein 2 OS=Homo sapiens GN=PMS2P2 PE=5 SV=1 10 183 1.0E-20
sp|A4D2B8|PM2P1_HUMAN Putative postmeiotic segregation increased 2-like protein 1 OS=Homo sapiens GN=PMS2P1 PE=5 SV=1 10 183 9.0E-20
sp|Q12083|MLH3_YEAST DNA mismatch repair protein MLH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MLH3 PE=1 SV=1 12 173 2.0E-18
sp|F4JN26|MLH3_ARATH DNA mismatch repair protein MLH3 OS=Arabidopsis thaliana GN=MLH3 PE=2 SV=2 10 204 1.0E-17
sp|Q9UHC1|MLH3_HUMAN DNA mismatch repair protein Mlh3 OS=Homo sapiens GN=MLH3 PE=1 SV=3 22 307 2.0E-15
sp|Q07980|MLH2_YEAST DNA mismatch repair protein MLH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MLH2 PE=1 SV=1 22 203 2.0E-13
sp|Q13401|PM2P3_HUMAN Putative postmeiotic segregation increased 2-like protein 3 OS=Homo sapiens GN=PMS2P3 PE=5 SV=2 3 77 2.0E-09
sp|Q13670|PM2PB_HUMAN Putative postmeiotic segregation increased 2-like protein 11 OS=Homo sapiens GN=PMS2P11 PE=5 SV=1 10 77 1.0E-08
sp|B0BA28|MUTL_CHLTB DNA mismatch repair protein MutL OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=mutL PE=3 SV=1 293 367 3.0E-06
sp|B0B8E9|MUTL_CHLT2 DNA mismatch repair protein MutL OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=mutL PE=3 SV=1 293 367 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0030983 mismatched DNA binding Yes
GO:0006298 mismatch repair Yes
GO:0071704 organic substance metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0003677 DNA binding No
GO:0046483 heterocycle metabolic process No
GO:0008152 metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:0032559 adenyl ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006974 cellular response to DNA damage stimulus No
GO:1901360 organic cyclic compound metabolic process No
GO:0043167 ion binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0030554 adenyl nucleotide binding No
GO:0036094 small molecule binding No
GO:0006259 DNA metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0051716 cellular response to stimulus No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0032553 ribonucleotide binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0017076 purine nucleotide binding No
GO:0003674 molecular_function No
GO:0033554 cellular response to stress No
GO:0006950 response to stress No
GO:0006281 DNA repair No
GO:0003690 double-stranded DNA binding No
GO:0006807 nitrogen compound metabolic process No
GO:0050896 response to stimulus No
GO:0043170 macromolecule metabolic process No
GO:0090304 nucleic acid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|018900
MSQEQEQGPKPIRRLEDSLINRIAAGEIIHRPASALKELIENCLDAGSTSIRITVKDGGMKLLQIQDNGCGIRKT
DLPILAERFTTSKLSTFDDLSRIQTYGFRGEALASMSHVAHLSVITKTKSEPVAWKASYIDGVLVDPRTRQSSEP
RACAGNDGTTITIEDLFYNTPTRLQAFRNISEEYSRILDVITKYAIHNPKVSFSCKKATSSSPDIATPGSMSVQQ
AIRLLYGHSLATQLIETNISSDKPENPDNEDSNDDEAMDVDLPSSTNWSAELHFSNANYQAKKTTFLLFINHRLV
ESSRMKRSFEAVYHGVLPKGAFPFVYLSLDIDPRCVDVNVHPTKREVHFLKEEEITERISDITQQKLALQGQSRT
FEYQTLLTANTAGPSITRKRSRKETEENDVEDEMDEIPGPSAPQEKRPTYSYHKVRTSLKDRTLDSMFPVSSPAQ
IDLNENEKGKGKASTQGTPTATKSRLIEESSCLLTSVTKLRQNVVKNKHRQLTEILQKHIFVGIVDTHKCLSLIQ
HSTDMYLVNHSSLAEELFYQLGLRQFGDMSRLKLQPAPSLKDLLEISVEAEESTKESNLTKPQIVEKIAQMIITR
RDMLAEYFSLNISESGLVQSIPLLLRDFIPNLDYLPMFLMRLGPQVNWQSEAECFDTFLRELAYFYSLGATFSQT
PQSESSEGQEPQDKAERWQIQHVLFPAMRHYILAPKSLLERDVVQVASLHDLYKVFERC*
Coding >AgabiH97|018900
ATGTCTCAAGAACAGGAGCAAGGGCCAAAGCCTATTCGTCGTCTCGAGGATTCCTTAATCAATCGGATAGCAGCA
GGAGAAATTATCCACCGCCCCGCTTCAGCTTTGAAAGAACTTATTGAGAACTGTCTTGATGCTGGTTCGACTTCG
ATACGAATCACCGTCAAAGACGGAGGAATGAAACTCCTGCAAATTCAGGACAATGGATGCGGTATACGCAAAACC
GATTTGCCCATCCTCGCGGAGAGGTTTACCACGTCAAAATTGTCGACATTTGACGACTTGTCTCGTATCCAAACC
TATGGCTTTCGTGGGGAAGCATTGGCCTCAATGTCCCATGTTGCTCACCTTTCGGTCATTACGAAAACAAAAAGT
GAACCCGTAGCCTGGAAGGCGTCTTATATAGATGGTGTGTTGGTTGACCCGCGGACGCGTCAAAGCAGTGAACCT
AGAGCCTGCGCCGGAAATGACGGGACAACTATCACCATCGAGGACCTGTTCTATAATACACCCACGCGGCTTCAA
GCATTCCGGAATATATCAGAAGAATATTCTCGTATTCTGGATGTTATCACCAAATACGCCATTCACAATCCCAAG
GTGTCTTTCTCATGTAAGAAGGCTACTTCGTCTTCTCCTGATATTGCAACGCCCGGCTCTATGTCTGTTCAGCAA
GCAATTCGGTTGTTATATGGACACTCTCTTGCGACTCAGCTAATCGAAACCAACATATCTTCGGACAAGCCAGAA
AATCCAGATAACGAGGACAGCAATGATGATGAAGCAATGGATGTCGACCTACCTTCCAGTACGAATTGGTCCGCG
GAATTGCATTTCAGCAACGCCAACTATCAAGCCAAAAAGACGACTTTCCTTCTCTTTATCAACCACCGCCTGGTC
GAGTCCTCACGTATGAAGCGCTCTTTCGAAGCTGTCTATCATGGAGTCCTTCCCAAAGGAGCATTTCCATTTGTT
TATCTCAGCTTAGACATCGATCCTCGTTGTGTAGATGTCAATGTTCACCCAACCAAACGAGAGGTCCATTTCCTC
AAAGAAGAGGAGATCACCGAGCGAATTTCTGATATTACGCAACAAAAGCTGGCTTTGCAAGGACAATCACGAACT
TTTGAGTACCAGACGTTACTAACGGCGAATACTGCTGGACCCTCTATCACACGAAAGCGAAGCAGGAAGGAGACT
GAGGAGAACGATGTCGAGGACGAGATGGACGAGATACCTGGACCTTCTGCACCACAGGAGAAGAGACCAACCTAT
TCCTACCACAAGGTCCGAACATCCCTCAAAGATAGGACTCTTGATTCCATGTTTCCGGTGTCAAGTCCAGCGCAA
ATCGACCTCAATGAGAACGAAAAAGGAAAAGGAAAAGCATCCACTCAAGGGACGCCTACGGCAACTAAATCCCGT
TTGATTGAGGAGTCATCATGTCTTTTAACTTCGGTGACTAAATTGAGGCAGAACGTAGTGAAAAATAAACATCGT
CAACTGACCGAAATACTCCAGAAGCATATTTTTGTCGGAATCGTGGATACACACAAATGCCTCTCACTCATACAA
CATTCGACCGACATGTATCTCGTGAACCACAGTTCACTCGCGGAAGAGCTTTTCTATCAGCTGGGTCTTCGTCAG
TTCGGCGATATGAGTAGGCTCAAGCTTCAGCCTGCACCCTCCTTGAAAGATCTCTTGGAAATCTCCGTTGAGGCT
GAAGAATCCACAAAAGAGAGCAATCTTACTAAACCGCAAATCGTCGAGAAAATAGCGCAGATGATCATCACACGA
CGGGACATGCTCGCTGAATACTTTTCCCTTAACATCTCAGAATCAGGCCTCGTACAGAGTATTCCACTTTTGTTG
CGGGATTTTATCCCTAATCTCGATTACTTGCCGATGTTTTTAATGAGGCTAGGGCCACAAGTGAATTGGCAATCG
GAGGCCGAATGTTTTGACACGTTTCTACGCGAGCTTGCGTACTTCTATAGCTTGGGAGCAACCTTCTCTCAAACT
CCGCAGTCCGAGTCATCCGAGGGGCAAGAACCTCAGGATAAAGCCGAGCGGTGGCAGATACAGCATGTCCTGTTC
CCGGCCATGCGTCATTACATCCTAGCTCCGAAATCTTTGTTGGAACGTGATGTTGTCCAGGTTGCAAGCTTACAC
GACCTGTATAAAGTCTTCGAAAGATGTTGA
Transcript >AgabiH97|018900
ATGTCTCAAGAACAGGAGCAAGGGCCAAAGCCTATTCGTCGTCTCGAGGATTCCTTAATCAATCGGATAGCAGCA
GGAGAAATTATCCACCGCCCCGCTTCAGCTTTGAAAGAACTTATTGAGAACTGTCTTGATGCTGGTTCGACTTCG
ATACGAATCACCGTCAAAGACGGAGGAATGAAACTCCTGCAAATTCAGGACAATGGATGCGGTATACGCAAAACC
GATTTGCCCATCCTCGCGGAGAGGTTTACCACGTCAAAATTGTCGACATTTGACGACTTGTCTCGTATCCAAACC
TATGGCTTTCGTGGGGAAGCATTGGCCTCAATGTCCCATGTTGCTCACCTTTCGGTCATTACGAAAACAAAAAGT
GAACCCGTAGCCTGGAAGGCGTCTTATATAGATGGTGTGTTGGTTGACCCGCGGACGCGTCAAAGCAGTGAACCT
AGAGCCTGCGCCGGAAATGACGGGACAACTATCACCATCGAGGACCTGTTCTATAATACACCCACGCGGCTTCAA
GCATTCCGGAATATATCAGAAGAATATTCTCGTATTCTGGATGTTATCACCAAATACGCCATTCACAATCCCAAG
GTGTCTTTCTCATGTAAGAAGGCTACTTCGTCTTCTCCTGATATTGCAACGCCCGGCTCTATGTCTGTTCAGCAA
GCAATTCGGTTGTTATATGGACACTCTCTTGCGACTCAGCTAATCGAAACCAACATATCTTCGGACAAGCCAGAA
AATCCAGATAACGAGGACAGCAATGATGATGAAGCAATGGATGTCGACCTACCTTCCAGTACGAATTGGTCCGCG
GAATTGCATTTCAGCAACGCCAACTATCAAGCCAAAAAGACGACTTTCCTTCTCTTTATCAACCACCGCCTGGTC
GAGTCCTCACGTATGAAGCGCTCTTTCGAAGCTGTCTATCATGGAGTCCTTCCCAAAGGAGCATTTCCATTTGTT
TATCTCAGCTTAGACATCGATCCTCGTTGTGTAGATGTCAATGTTCACCCAACCAAACGAGAGGTCCATTTCCTC
AAAGAAGAGGAGATCACCGAGCGAATTTCTGATATTACGCAACAAAAGCTGGCTTTGCAAGGACAATCACGAACT
TTTGAGTACCAGACGTTACTAACGGCGAATACTGCTGGACCCTCTATCACACGAAAGCGAAGCAGGAAGGAGACT
GAGGAGAACGATGTCGAGGACGAGATGGACGAGATACCTGGACCTTCTGCACCACAGGAGAAGAGACCAACCTAT
TCCTACCACAAGGTCCGAACATCCCTCAAAGATAGGACTCTTGATTCCATGTTTCCGGTGTCAAGTCCAGCGCAA
ATCGACCTCAATGAGAACGAAAAAGGAAAAGGAAAAGCATCCACTCAAGGGACGCCTACGGCAACTAAATCCCGT
TTGATTGAGGAGTCATCATGTCTTTTAACTTCGGTGACTAAATTGAGGCAGAACGTAGTGAAAAATAAACATCGT
CAACTGACCGAAATACTCCAGAAGCATATTTTTGTCGGAATCGTGGATACACACAAATGCCTCTCACTCATACAA
CATTCGACCGACATGTATCTCGTGAACCACAGTTCACTCGCGGAAGAGCTTTTCTATCAGCTGGGTCTTCGTCAG
TTCGGCGATATGAGTAGGCTCAAGCTTCAGCCTGCACCCTCCTTGAAAGATCTCTTGGAAATCTCCGTTGAGGCT
GAAGAATCCACAAAAGAGAGCAATCTTACTAAACCGCAAATCGTCGAGAAAATAGCGCAGATGATCATCACACGA
CGGGACATGCTCGCTGAATACTTTTCCCTTAACATCTCAGAATCAGGCCTCGTACAGAGTATTCCACTTTTGTTG
CGGGATTTTATCCCTAATCTCGATTACTTGCCGATGTTTTTAATGAGGCTAGGGCCACAAGTGAATTGGCAATCG
GAGGCCGAATGTTTTGACACGTTTCTACGCGAGCTTGCGTACTTCTATAGCTTGGGAGCAACCTTCTCTCAAACT
CCGCAGTCCGAGTCATCCGAGGGGCAAGAACCTCAGGATAAAGCCGAGCGGTGGCAGATACAGCATGTCCTGTTC
CCGGCCATGCGTCATTACATCCTAGCTCCGAAATCTTTGTTGGAACGTGATGTTGTCCAGGTTGCAAGCTTACAC
GACCTGTATAAAGTCTTCGAAAGATGTTGA
Gene >AgabiH97|018900
ATGTCTCAAGAACAGGAGCAAGGGCCAAAGCCTATTCGTCGTCTCGAGGATTCCTTAATCAATCGGATAGCAGCA
GGAGAAGTGAGTCTTTACTACAGAATTTATGCAGATATTGTTTGAACGACGGAAGATTATCCACCGCCCCGCTTC
AGCTTTGAAAGAACTTATTGAGAACTGTCTTGATGCTGGTTCGACTTCGATACGAATCACCGTCAAAGACGGAGG
AATGAAACTCCTGCAAATTCAGGACAATGGATGCGGTATACGCGTAAGTCGTCCAAATGTTATAGTGACCTCGTG
TCTGACAAACGCGTCTTGCAGAAAACCGATTTGCCCATCCTCGCGGAGAGGTTTACCACGTCAAAATTGTCGACA
TTTGACGACTTGTCTCGTATCCAAACCTATGGCTTTCGTGGGGAAGCATTGGCCTCAATGTCCCATGTTGCTCAC
CTTTCGGTCATTACGAAAACAAAAAGTGAACCCGTAGCCTGGAAGTATGTCCCTTGTTTCTCGATTCAATGTTAT
TCCTGACAAGCGCTATATCAGGGCGTCTTATATAGATGGTGTGTTGGTTGACCCGCGGACGCGTCAAAGCAGTGA
ACCTAGAGCCTGCGCCGGAAATGACGGGACAACTATCACCGTACGTAGCAGTCCACCCCGGGCGAGTCGATTCTC
ATCTCTCAATAGATCGAGGACCTGTTCTATAATACACCCACGCGGCTTCAAGCATTCCGGAATATATCAGAAGAA
TATTCTCGTATTCTGGATGTTATCACCAAATACGCCATTCACAATCCCAAGGTGTCTTTCTCATGTAAGAAGGTA
TGCAAAAAAGATTTCTCGTTAATATACAATTAACACCTCTACTAGGCTACTTCGTCTTCTCCTGATATTGCAACG
CCCGGCTCTATGTCTGTTCAGCAAGCAATTCGGTTGTTATATGGACACTCTCTTGCGACTCAGCTAATCGAAACC
AACATATCTTCGGACAAGCCAGAAAATCCAGATAACGAGGACAGCAATGATGATGAAGCAATGGATGTCGACCTA
CCTTCCAGTACGAATTGGTCCGCGGAATTGCATTTCAGCAACGCCAACTATCAAGCCAAAAAGACGACTTTCCTT
CTCTTTATCAACCGTGAGTGATCCACTGTGGTCATAATTAAATCTCATTCTTGTCAGACCGCCTGGTCGAGTCCT
CACGTATGAAGCGCTCTTTCGAAGCTGTCTATCATGGAGTCCTTCCCAAAGGAGCATTTCCATTTGTTTATCTCA
GGTACACCTGGCAAAATGTCGTCACTGAATCTGATAATGACGAATGTCCGATAGCTTAGACATCGATCCTCGTTG
TGTAGATGTCAATGTTCACCCAACCAAACGAGAGGTCCATTTCCTCAAAGAAGAGGAGATCACCGAGCGAATTTC
TGATATTACGCAACAAAAGCTGGCTTTGCAAGGACAATCACGAACTTTTGAGTACCAGGTGACGCCAAGCATCTT
TGTCTTTTGCCGTCGATTCTCACATCAACCAGACGTTACTAACGGCGAATACTGCTGGACCCTCTATCACACGAA
AGCGAAGCAGGAAGGAGACTGAGGAGAACGATGTCGAGGACGAGATGGACGAGATACCTGGACCTTCTGCACGTA
AGTCTTAGCCCCATTGAATTAACTCTCTGTGTGTTAAGGAACGCCTCTTTCAGCACAGGAGAAGAGACCAACCTA
TTCCTACCACAAGGTCCGAACATCCCTCAAAGATAGGACTCTTGATTCCATGTTTCCGGTGTCAAGTCCAGCGCA
AATCGACCTCAATGAGAACGAAAAAGGAAAAGGAAAAGCATCCACTCAAGGGACGCCTACGGCAACTAAATCCCG
TTTGATTGAGGAGTCATCATGTCTTTTAACTTCGGTGACTAAATTGAGGCAGAACGTAGTGAAAAATAAACATCG
TCGTAAGTATTCAAATCCGCATGATGGTGAGCTAGCTGATCAAGTGTTGTTTAGAACTGACCGAAATACTCCAGA
AGCATATTTTTGTCGGAATCGTGGATACACACAAATGCCTCTCACTCATACAACATTCGACCGACATGTATCTCG
TGAACCACAGTTCACTCGCGTATGCCATATTAAATTCTTCCTTCCAGCGCTTCTTACAAATGGTCTGCGAATTTA
GGGAAGAGCTTTTCTATCAGCTGGGTCTTCGTCAGTTCGGCGATATGAGTAGGCTCAAGCTTCAGCCTGCACCCT
CCTTGAAAGATCTCTTGGAAATCTCCGTTGAGGCTGAAGAATCCACAAAAGAGAGCAATCTTACTAAACCGCAAA
TCGTCGAGGCATGTAGTTTGTTTTGTTCGGTCTGCATCGTTTTAAACTCAAGCACTGCGATCTATAGAAAATAGC
GCAGATGATCATCACACGACGGGACATGCTCGCTGAATACTTTTCCCTTAACATCTCAGAATCAGGCCTCGTACA
GAGTATTCCACTTTTGTTGCGGGATTTTATCCCTAATCTCGATTACTTGCCGATGTTTTTAATGAGGCTAGGGCC
ACAAGTACATCGTTCTTTTCTTTCCGAAAGCGAATACTTACTTTGCTTATAGGTGAATTGGCAATCGGAGGCCGA
ATGTTTTGACACGTTTCTACGCGAGCTTGCGTACTTCTATAGCTTGGGAGCAACCTTCTCTCAAACTCCGCAGTC
CGAGTCATCCGAGGGGCAAGAACCTCAGGATAAAGCCGAGCGGTGGCAGATACAGCATGTCCTGTTCCCGGCCAT
GCGTCATTACATCCTAGCTCCGAAATCTTTGTTGGAACGTGATGTTGTCCAGGTTGCAAGCTTACACGACCTGTA
TAAAGTCTTCGAAAGATGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail