Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|018870
Gene name
Locationscaffold_10:1036151..1039586
Strand+
Gene length (bp)3435
Transcript length (bp)2835
Coding sequence length (bp)2835
Protein length (aa) 945

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17781 RPN1_RPN2_N RPN1 N-terminal domain 1.9E-114 60 390
PF18051 RPN1_C 26S proteasome non-ATPase regulatory subunit RPN1 C-terminal 1.2E-29 883 936

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87048|RPN1_SCHPO 26S proteasome regulatory subunit rpn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn1 PE=1 SV=2 8 933 0.0E+00
sp|Q4FZT9|PSMD2_RAT 26S proteasome non-ATPase regulatory subunit 2 OS=Rattus norvegicus GN=Psmd2 PE=1 SV=1 11 936 0.0E+00
sp|Q8VDM4|PSMD2_MOUSE 26S proteasome non-ATPase regulatory subunit 2 OS=Mus musculus GN=Psmd2 PE=1 SV=1 11 937 0.0E+00
sp|P56701|PSMD2_BOVIN 26S proteasome non-ATPase regulatory subunit 2 OS=Bos taurus GN=PSMD2 PE=1 SV=2 22 937 0.0E+00
sp|Q13200|PSMD2_HUMAN 26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens GN=PSMD2 PE=1 SV=3 22 937 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87048|RPN1_SCHPO 26S proteasome regulatory subunit rpn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn1 PE=1 SV=2 8 933 0.0E+00
sp|Q4FZT9|PSMD2_RAT 26S proteasome non-ATPase regulatory subunit 2 OS=Rattus norvegicus GN=Psmd2 PE=1 SV=1 11 936 0.0E+00
sp|Q8VDM4|PSMD2_MOUSE 26S proteasome non-ATPase regulatory subunit 2 OS=Mus musculus GN=Psmd2 PE=1 SV=1 11 937 0.0E+00
sp|P56701|PSMD2_BOVIN 26S proteasome non-ATPase regulatory subunit 2 OS=Bos taurus GN=PSMD2 PE=1 SV=2 22 937 0.0E+00
sp|Q13200|PSMD2_HUMAN 26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens GN=PSMD2 PE=1 SV=3 22 937 0.0E+00
sp|Q5R9I6|PSMD2_PONAB 26S proteasome non-ATPase regulatory subunit 2 OS=Pongo abelii GN=PSMD2 PE=2 SV=1 47 937 0.0E+00
sp|Q9SIV2|PSD2A_ARATH 26S proteasome non-ATPase regulatory subunit 2 homolog A OS=Arabidopsis thaliana GN=RPN1A PE=1 SV=2 49 939 0.0E+00
sp|Q6XJG8|PSD2B_ARATH 26S proteasome non-ATPase regulatory subunit 2 homolog B OS=Arabidopsis thaliana GN=RPN1B PE=1 SV=1 49 939 0.0E+00
sp|Q54BC6|PSMD2_DICDI 26S proteasome non-ATPase regulatory subunit 2 OS=Dictyostelium discoideum GN=psmD2 PE=1 SV=1 49 934 0.0E+00
sp|Q7S8R8|RPN1_NEUCR 26S proteasome regulatory subunit rpn-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rpn-1 PE=3 SV=2 4 939 0.0E+00
sp|P38764|RPN1_YEAST 26S proteasome regulatory subunit RPN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN1 PE=1 SV=3 53 654 5.0E-160
sp|Q6FPV6|RPN1_CANGA 26S proteasome regulatory subunit RPN1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPN1 PE=3 SV=1 13 654 2.0E-155
sp|Q6FPV6|RPN1_CANGA 26S proteasome regulatory subunit RPN1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPN1 PE=3 SV=1 681 940 4.0E-85
sp|P38764|RPN1_YEAST 26S proteasome regulatory subunit RPN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN1 PE=1 SV=3 681 940 1.0E-79
sp|Q8SS65|RPN1_ENCCU 26S proteasome regulatory subunit RPN1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPN1 PE=1 SV=1 57 933 1.0E-64
sp|Q5F418|PSMD1_CHICK 26S proteasome non-ATPase regulatory subunit 1 OS=Gallus gallus GN=PSMD1 PE=2 SV=1 389 868 9.0E-14
sp|Q99460|PSMD1_HUMAN 26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens GN=PSMD1 PE=1 SV=2 389 654 1.0E-13
sp|Q5R5S4|PSMD1_PONAB 26S proteasome non-ATPase regulatory subunit 1 OS=Pongo abelii GN=PSMD1 PE=2 SV=1 389 654 1.0E-13
sp|Q3TXS7|PSMD1_MOUSE 26S proteasome non-ATPase regulatory subunit 1 OS=Mus musculus GN=Psmd1 PE=1 SV=1 389 654 1.0E-13
sp|O88761|PSMD1_RAT 26S proteasome non-ATPase regulatory subunit 1 OS=Rattus norvegicus GN=Psmd1 PE=1 SV=1 389 654 2.0E-13
sp|Q9MAT0|PSD1B_ARATH 26S proteasome non-ATPase regulatory subunit 1 homolog B OS=Arabidopsis thaliana GN=RPN2B PE=1 SV=1 408 868 4.0E-13
sp|O48844|PSD1A_ARATH 26S proteasome non-ATPase regulatory subunit 1 homolog A OS=Arabidopsis thaliana GN=RPN2A PE=1 SV=1 408 906 8.0E-12
sp|Q54JM5|PSMD1_DICDI 26S proteasome non-ATPase regulatory subunit 1 OS=Dictyostelium discoideum GN=psmD1 PE=1 SV=1 408 762 9.0E-10
sp|O74762|RPN2_SCHPO 26S proteasome regulatory subunit rpn2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn2 PE=1 SV=1 408 869 2.0E-09
sp|Q18115|PSMD1_CAEEL 26S proteasome non-ATPase regulatory subunit 1 OS=Caenorhabditis elegans GN=rpn-2 PE=3 SV=4 396 872 9.0E-09
sp|P32565|RPN2_YEAST 26S proteasome regulatory subunit RPN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN2 PE=1 SV=4 327 871 2.0E-08
sp|Q9V3P6|PSMD1_DROME 26S proteasome non-ATPase regulatory subunit 1 OS=Drosophila melanogaster GN=Rpn2 PE=1 SV=1 343 868 5.0E-08
sp|Q75CF3|RPN2_ASHGO 26S proteasome regulatory subunit RPN2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPN2 PE=3 SV=1 383 833 1.0E-07
sp|Q6FIP2|RPN2_CANGA 26S proteasome regulatory subunit RPN2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPN2 PE=3 SV=1 344 654 4.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|018870
MTKAQEFSINVQSDDPKKKEKPGDEPDKQEGSSKLLGSTNAKEGEGEDLSEEDMQLKGELELLVERLKEPNTGLY
KAALETLRTLIRTSTSSMTSVPKPLKFLRPNYPDLQSLYETWSPSEDKSLFADILSVLAMTYSDTQPRGTLRYRL
LAAALRPPFSPLADPGSWGHEYVRHLAAELGEEYRLREEEAAGINGAAEHPALPGSTDDLRALAKDCAVFLLNHN
AEPDAVDLLEELEIVDEIVGLVDENTFSRVCQYMIRCVNLLPPPDDINFLTTAHAIYVQYRRFPEALALSIRLSN
PDMIREDFNAPGNPLMKRQLAFLIARAQIPLEWLHPIEDSDTEDMVEEFPEDLIECLSNAHLSMHFRDYGKELGV
LEPKSLEDVYKSHLENTRPGVTANIDSARANLAGTFVNAFVNAGFGNDKLLVEADEGNSWIYKNKDHGMLSATAS
LGLSLLWDTDIGLSHVDKYTYSSEENIKAGALLATGILNTGVRTEADAALALLGEYTENKSVPLKSAAFMGLGLA
YCGSHREDIIPYILPHVSDEAVTIEVSSLAALSLGFIFVGSKNGDVSTTMLQTLLEKYEEGDQGLDEKWAKFFIL
GLALLYLGAQEESDATIEFLKAIDHPISKTAQVLVEACAYAGTGNVLKIQTMLHHCDDHIGTPTEGGKDEKEEKA
DDTFQSFAVLAIALIAMGEEIGGEMALRQFNHLMHYGEPVIRKAIPLAIGLVSASNPQLPLLDTLSKYSHDNDLS
VAVNAIFAMGMVGAGTNNARLGQMLRQLAGYYQKEPDCLFMVRVAQGMVHMGKGTIGINPFFCDREIMSKAAVAG
LMGILTAFLDAKAFIFDKYHWMFFFLVPAMYPRFFITLDEDLRSIPVTVRVGQAVDVVGQAGKPRTISGFQTHQT
PVRLGTTERAELGTEEYISFAHVMEGFVILQKNPGWEKEDKMDV*
Coding >AgabiH97|018870
ATGACAAAAGCCCAGGAGTTCTCTATCAACGTTCAATCGGACGATCCAAAGAAGAAGGAAAAACCTGGAGATGAG
CCCGATAAACAAGAGGGTTCCTCCAAACTGCTCGGTTCGACCAATGCAAAGGAAGGCGAAGGCGAAGATCTTTCA
GAGGAGGACATGCAGTTGAAGGGGGAGCTTGAATTGCTCGTTGAACGGCTAAAGGAACCAAATACTGGGTTGTAT
AAAGCGGCACTGGAAACCCTCAGGACCCTCATCCGAACCTCTACGTCCTCAATGACTTCCGTGCCCAAGCCGCTC
AAGTTTCTGCGCCCCAACTATCCCGATCTACAATCCCTATACGAAACATGGTCTCCTTCCGAAGATAAGAGCCTT
TTTGCCGACATCCTTTCTGTTCTCGCAATGACGTATTCTGATACTCAACCCCGAGGCACTCTACGCTACCGCCTT
CTTGCCGCTGCGCTCCGTCCACCCTTTTCTCCTCTCGCAGATCCAGGCTCATGGGGTCATGAGTATGTCCGCCAT
CTTGCTGCAGAACTTGGTGAAGAGTACAGGTTGCGCGAGGAGGAAGCTGCTGGCATCAACGGGGCCGCTGAGCAT
CCTGCCCTCCCCGGTTCCACCGACGACCTTCGCGCCCTTGCCAAGGATTGTGCTGTTTTCCTGCTGAATCATAAT
GCCGAACCGGACGCTGTGGATCTCCTAGAGGAGCTGGAAATAGTAGACGAGATTGTTGGGCTCGTAGACGAAAAT
ACTTTTAGTCGGGTGTGCCAGTACATGATTCGATGTGTCAACCTCCTTCCTCCCCCCGACGATATCAACTTTTTG
ACCACGGCACATGCGATCTACGTCCAGTATCGTAGATTCCCCGAAGCTCTCGCCCTCTCTATCAGACTCTCCAAC
CCAGATATGATCCGTGAAGACTTTAATGCTCCAGGGAATCCTTTGATGAAGCGTCAACTGGCATTCTTAATTGCT
CGAGCACAAATACCACTAGAATGGCTGCATCCCATCGAAGACTCAGACACCGAAGATATGGTCGAGGAATTCCCA
GAAGACTTGATCGAGTGCTTAAGCAACGCTCATCTGAGCATGCATTTCCGAGATTATGGTAAAGAACTGGGAGTG
TTGGAACCCAAGTCCCTCGAAGACGTGTACAAATCGCATTTGGAAAACACAAGACCGGGTGTGACCGCTAATATC
GATTCCGCAAGAGCCAACTTAGCCGGAACATTTGTGAATGCTTTCGTGAATGCCGGCTTTGGTAATGACAAGTTG
TTGGTGGAGGCAGATGAAGGTAACAGTTGGATATACAAAAACAAGGATCATGGTATGTTGAGCGCCACTGCATCC
TTGGGCTTGAGTTTGCTCTGGGACACCGACATCGGTCTTTCGCACGTTGACAAGTATACCTACTCCTCAGAGGAG
AATATCAAGGCTGGAGCACTTCTTGCCACTGGTATTCTCAATACGGGTGTGCGAACGGAAGCAGACGCGGCATTG
GCTCTTCTTGGGGAATACACAGAAAACAAGTCTGTTCCCCTGAAAAGTGCAGCTTTCATGGGCCTTGGATTGGCG
TATTGCGGCTCTCATCGTGAAGACATTATTCCCTATATCCTTCCACACGTCTCGGATGAGGCTGTGACCATTGAG
GTCTCATCATTAGCTGCGCTATCACTTGGGTTCATATTCGTCGGAAGCAAGAATGGGGATGTATCGACGACGATG
TTGCAAACCCTCTTGGAGAAGTATGAAGAAGGCGATCAAGGATTAGACGAGAAATGGGCAAAATTCTTTATCCTC
GGTTTGGCCTTACTTTATCTTGGTGCTCAGGAAGAATCAGATGCAACAATTGAATTCCTCAAGGCCATTGATCAT
CCTATCTCCAAAACTGCGCAAGTTTTAGTCGAAGCGTGTGCGTACGCAGGGACGGGCAACGTGCTCAAGATCCAG
ACTATGCTGCATCATTGTGATGACCACATCGGTACACCAACAGAAGGCGGGAAGGACGAGAAGGAAGAGAAGGCT
GACGATACGTTCCAGTCCTTTGCTGTACTTGCTATAGCCCTCATTGCCATGGGTGAAGAGATCGGGGGTGAGATG
GCGTTGAGACAGTTCAACCACCTCATGCATTATGGTGAACCTGTCATCCGCAAAGCCATTCCCTTGGCCATTGGA
CTCGTTAGCGCCTCAAATCCCCAACTTCCTCTTCTAGACACCTTATCAAAATACAGTCATGACAATGATCTTAGC
GTTGCCGTCAATGCTATTTTCGCTATGGGTATGGTCGGCGCTGGTACGAACAATGCTCGCTTAGGCCAAATGCTC
AGGCAATTGGCTGGTTATTACCAAAAAGAGCCAGACTGCTTGTTCATGGTGCGCGTCGCTCAAGGAATGGTACAC
ATGGGCAAGGGAACTATCGGAATCAACCCTTTCTTCTGCGATCGAGAGATTATGAGCAAAGCTGCCGTAGCTGGT
CTGATGGGTATTTTGACTGCTTTCTTGGATGCTAAAGCTTTTATATTTGATAAATACCATTGGATGTTCTTCTTC
CTTGTTCCTGCGATGTATCCTCGATTCTTCATTACCCTCGACGAAGACCTACGGAGTATTCCGGTGACAGTCCGT
GTAGGTCAAGCCGTGGACGTGGTTGGACAAGCGGGCAAGCCGAGGACGATATCCGGATTCCAGACGCACCAAACG
CCTGTACGGCTTGGCACGACAGAGAGAGCTGAACTGGGAACGGAGGAGTATATTTCGTTTGCGCATGTGATGGAG
GGATTTGTGATCCTACAAAAGAACCCAGGTTGGGAGAAAGAAGATAAAATGGATGTATAG
Transcript >AgabiH97|018870
ATGACAAAAGCCCAGGAGTTCTCTATCAACGTTCAATCGGACGATCCAAAGAAGAAGGAAAAACCTGGAGATGAG
CCCGATAAACAAGAGGGTTCCTCCAAACTGCTCGGTTCGACCAATGCAAAGGAAGGCGAAGGCGAAGATCTTTCA
GAGGAGGACATGCAGTTGAAGGGGGAGCTTGAATTGCTCGTTGAACGGCTAAAGGAACCAAATACTGGGTTGTAT
AAAGCGGCACTGGAAACCCTCAGGACCCTCATCCGAACCTCTACGTCCTCAATGACTTCCGTGCCCAAGCCGCTC
AAGTTTCTGCGCCCCAACTATCCCGATCTACAATCCCTATACGAAACATGGTCTCCTTCCGAAGATAAGAGCCTT
TTTGCCGACATCCTTTCTGTTCTCGCAATGACGTATTCTGATACTCAACCCCGAGGCACTCTACGCTACCGCCTT
CTTGCCGCTGCGCTCCGTCCACCCTTTTCTCCTCTCGCAGATCCAGGCTCATGGGGTCATGAGTATGTCCGCCAT
CTTGCTGCAGAACTTGGTGAAGAGTACAGGTTGCGCGAGGAGGAAGCTGCTGGCATCAACGGGGCCGCTGAGCAT
CCTGCCCTCCCCGGTTCCACCGACGACCTTCGCGCCCTTGCCAAGGATTGTGCTGTTTTCCTGCTGAATCATAAT
GCCGAACCGGACGCTGTGGATCTCCTAGAGGAGCTGGAAATAGTAGACGAGATTGTTGGGCTCGTAGACGAAAAT
ACTTTTAGTCGGGTGTGCCAGTACATGATTCGATGTGTCAACCTCCTTCCTCCCCCCGACGATATCAACTTTTTG
ACCACGGCACATGCGATCTACGTCCAGTATCGTAGATTCCCCGAAGCTCTCGCCCTCTCTATCAGACTCTCCAAC
CCAGATATGATCCGTGAAGACTTTAATGCTCCAGGGAATCCTTTGATGAAGCGTCAACTGGCATTCTTAATTGCT
CGAGCACAAATACCACTAGAATGGCTGCATCCCATCGAAGACTCAGACACCGAAGATATGGTCGAGGAATTCCCA
GAAGACTTGATCGAGTGCTTAAGCAACGCTCATCTGAGCATGCATTTCCGAGATTATGGTAAAGAACTGGGAGTG
TTGGAACCCAAGTCCCTCGAAGACGTGTACAAATCGCATTTGGAAAACACAAGACCGGGTGTGACCGCTAATATC
GATTCCGCAAGAGCCAACTTAGCCGGAACATTTGTGAATGCTTTCGTGAATGCCGGCTTTGGTAATGACAAGTTG
TTGGTGGAGGCAGATGAAGGTAACAGTTGGATATACAAAAACAAGGATCATGGTATGTTGAGCGCCACTGCATCC
TTGGGCTTGAGTTTGCTCTGGGACACCGACATCGGTCTTTCGCACGTTGACAAGTATACCTACTCCTCAGAGGAG
AATATCAAGGCTGGAGCACTTCTTGCCACTGGTATTCTCAATACGGGTGTGCGAACGGAAGCAGACGCGGCATTG
GCTCTTCTTGGGGAATACACAGAAAACAAGTCTGTTCCCCTGAAAAGTGCAGCTTTCATGGGCCTTGGATTGGCG
TATTGCGGCTCTCATCGTGAAGACATTATTCCCTATATCCTTCCACACGTCTCGGATGAGGCTGTGACCATTGAG
GTCTCATCATTAGCTGCGCTATCACTTGGGTTCATATTCGTCGGAAGCAAGAATGGGGATGTATCGACGACGATG
TTGCAAACCCTCTTGGAGAAGTATGAAGAAGGCGATCAAGGATTAGACGAGAAATGGGCAAAATTCTTTATCCTC
GGTTTGGCCTTACTTTATCTTGGTGCTCAGGAAGAATCAGATGCAACAATTGAATTCCTCAAGGCCATTGATCAT
CCTATCTCCAAAACTGCGCAAGTTTTAGTCGAAGCGTGTGCGTACGCAGGGACGGGCAACGTGCTCAAGATCCAG
ACTATGCTGCATCATTGTGATGACCACATCGGTACACCAACAGAAGGCGGGAAGGACGAGAAGGAAGAGAAGGCT
GACGATACGTTCCAGTCCTTTGCTGTACTTGCTATAGCCCTCATTGCCATGGGTGAAGAGATCGGGGGTGAGATG
GCGTTGAGACAGTTCAACCACCTCATGCATTATGGTGAACCTGTCATCCGCAAAGCCATTCCCTTGGCCATTGGA
CTCGTTAGCGCCTCAAATCCCCAACTTCCTCTTCTAGACACCTTATCAAAATACAGTCATGACAATGATCTTAGC
GTTGCCGTCAATGCTATTTTCGCTATGGGTATGGTCGGCGCTGGTACGAACAATGCTCGCTTAGGCCAAATGCTC
AGGCAATTGGCTGGTTATTACCAAAAAGAGCCAGACTGCTTGTTCATGGTGCGCGTCGCTCAAGGAATGGTACAC
ATGGGCAAGGGAACTATCGGAATCAACCCTTTCTTCTGCGATCGAGAGATTATGAGCAAAGCTGCCGTAGCTGGT
CTGATGGGTATTTTGACTGCTTTCTTGGATGCTAAAGCTTTTATATTTGATAAATACCATTGGATGTTCTTCTTC
CTTGTTCCTGCGATGTATCCTCGATTCTTCATTACCCTCGACGAAGACCTACGGAGTATTCCGGTGACAGTCCGT
GTAGGTCAAGCCGTGGACGTGGTTGGACAAGCGGGCAAGCCGAGGACGATATCCGGATTCCAGACGCACCAAACG
CCTGTACGGCTTGGCACGACAGAGAGAGCTGAACTGGGAACGGAGGAGTATATTTCGTTTGCGCATGTGATGGAG
GGATTTGTGATCCTACAAAAGAACCCAGGTTGGGAGAAAGAAGATAAAATGGATGTATAG
Gene >AgabiH97|018870
ATGACAAAAGCCCAGGAGTTCTCTATCAACGTTCAATCGGACGATCCAAAGAAGAAGGAAAAACCTGGAGATGAG
CCCGATAAACAAGAGGGTTCCTCCAAACTGCTCGGTTCGACCAATGCAAAGGAAGGCGAAGGCGAAGATCTTGTA
CGTTGCTTCTCGATCTACACTCCTTTTGCTAGTTTGCTGATAAATACCTACCCCAGTCAGAGGAGGACATGCAGT
TGAAGGGGGAGCTTGAATTGCTCGTTGAACGGCTAAAGGTAACTAGAAATTCTTACATCGTCCTATTACTAACTC
TTCCGTAGGAACCAAATACTGGGTTGTATAAAGCGGCACTGGAAACCCTCAGGACCCTCATCCGAACCTCTACGT
CCTCAATGACTTCCGTGCCCAAGCCGCTCAAGTTTCTGCGCCCCAACTATCCCGATCTACAATCCCTATACGAAA
CATGGTCTCCTTCCGAAGATAAGGTATAGAGTCCATGGTTGATATTCAAAGTGCTGAATCTCACTCGCGAACTAG
AGCCTTTTTGCCGACATCCTTTCTGTTCTCGCAATGACGTATTCTGATACTCAACCCCGAGGCACTCTACGCTAC
CGCCTTCTTGCCGCTGCGCTCCGTCCACCCTTTTCTCCTCTCGCAGATCCAGGCTCATGGGGTCATGAGTATGTC
CGCCATCTTGCTGCAGAACTTGGTGAAGAGTACAGGTTGCGCGAGGAGGAAGCTGCTGGCATCAACGGGGCCGCT
GAGCATCCTGCCCTCCCCGGTTCCACCGACGACCTTCGCGCCCTTGCCAAGGATTGTGCTGTTTTCCTGCTGAAT
CATAATGCCGAACCGGACGCTGTGGATCTCCTAGAGGAGCTGGAAATAGTAGACGAGATTGTTGGGCTCGTAGAC
GAAAATACTTTTAGTCGGGTGTGCCAGTACATGATTCGGTTCGTCCTCGCAGCATATGTTGGTTATATCAATCAT
TCATGTTCTTTTGGCCTGATGATAGATGTGTCAACCTCCTTCCTCCCCCCGACGATATCAACTTTTTGACCACGG
CACATGCGATCTACGTCCAGTATCGTAGATTCCCCGAAGCTCTCGCCCTCTCTATCAGACTCTCCAACCCAGATA
TGATCCGTGAAGACTTTAATGCTCCAGGGAATCCGTAAGGTTACGTTGATTATTCACTTAGGTCGCCGTGCTGAT
ATTTAATTAATCAGTTTGATGAAGCGTCAACTGGCATTCTTAATTGCTCGAGCACAAATACCACTAGAATGGCTG
CATCCCATCGAAGACTCAGACACCGAAGATATGGTCGAGGAATTCCCAGAAGACTTGATCGAGTGCTTAAGCAAC
GCTCATCTGAGCATGCATTTCCGAGATTATGGTAAAGAACTGGGAGTGTTGGAACCCAAGTCCCTCGAAGACGTG
TACAAATCGCATTTGGAAAACACAAGTACTCCCTGCCCCTTACACGAATGATTCCTTATGCTGACGGTTACTTTA
GGACCGGGTGTGACCGCTAATATCGATTCCGCAAGAGCCAACTTAGCCGGAACATTTGTGAATGCTTTCGTGAAT
GCCGGCTTTGGTAATGACAAGTTGTTGGTGGAGGCAGATGAAGGTAACAGTTGGATATACAAAAACAAGGATCAT
GGTACTGTTTTCATTTTGTCTCAACCAATGCCTTCTTCTAACCGATTTATAGGTATGTTGAGCGCCACTGCATCC
TTGGGCTTGAGTTTGCTCTGGGACACCGACATCGGTCTTTCGCACGTTGACAAGTATACCTACTCCTCAGAGGAG
AATATCAAGGTAGATATCTCATTCGTAGAGGTATTTTCAATTGAGCTCAATTGTTTTCACAGGCTGGAGCACTTC
TTGCCACTGGTATTCTCAATACGGGTGTGCGAACGGAAGCAGACGCGGCATTGGCTCTTCTTGGGGAATACACAG
AAAACAAGTCTGTTCCCCTGAAAAGTGCAGCTTTCATGGGCCTTGGATTGGCGTATTGCGGCTCTCATCGTGAAG
ACATTATTCCCTATATCCTTCCACACGTCTCGGATGAGGCTGTGACCATTGAGGTCTCATCATTAGCTGCGCTAT
CACTTGGGTTCATATTCGTCGGAAGCAAGAATGGGGATGTATCGACGACGATGTTGCAAACCCTCTTGGAGAAGT
ATGAAGAAGGCGATCAAGGATTAGACGAGAAATGGGCAAAATTCTTTATCCTCGGTTTGGCCTTACTTTATCTTG
GTAAGTATCGTTGTTTTATTCTTATCGAAGATCTTTAATACTTCGACGTAGGTGCTCAGGAAGAATCAGATGCAA
CAATTGAATTCCTCAAGGCCATTGATCATCCTATCTCCAAAACTGCGCAAGTTTTAGTCGAAGCGTGTGCGTACG
CAGGGACGGGCAACGTGCTCAAGATCCAGACTATGCTGCATCATTGTGATGACCACATCGGTACACCAACAGAAG
GCGGGAAGGACGAGAAGGAAGAGAAGGCTGACGATACGTTCCAGTCCTTTGCTGTACTTGCTATAGCCCTCATTG
CCATGGGTGAAGAGATCGGGGGTGAGATGGCGTTGAGACAGTTCAACCACCTCGTAAGTTGGAAGCTCAGTGCTA
TTTTTCCGCGCCTCCAAACTCACAGTTTTCTTCTTCAACTCAGATGCATTATGGTGAACCTGTCATCCGCAAAGC
CATTCCCTTGGCCATTGGACTCGTTAGCGCCTCAAATCCCCAACTTCCTCTTCTAGACACCTTATCAAAATACAG
TCATGACAATGATCTTAGCGTTGCCGTCAATGCTATTTTCGCTATGGGTATGGTCGGCGCTGGTACGAACAATGC
TCGCTTAGGCCAAATGCTCAGGCAATTGGCTGGTTATTACCAAAAAGAGCCAGACTGCTTGTTCATGGTGCGCGT
CGCTCAAGGAATGGTACACATGGGCAAGGGAACTATCGGAATCAACCCTTTCTTCTGCGATCGAGAGATTATGAG
CAAAGCTGCCGTAGCTGGTCTGATGGGTATTTTGACTGCTTTCTTGGATGCTAAAGCTTGTGAGTCATTCGATAT
GAAAATCACTTTCACCACATCTAAAACAATTTCCTTGAAGTTATATTTGATAAATACCATTGGATGTTCTTCTTC
CTTGTTCCTGCGATGTATCCTCGATTCTTCATTACCCTCGACGAAGACCTACGGAGTATTCCGGTGACAGTCCGT
GTAGGTCAAGCCGTGGACGTGGTTGGACAAGCGGGCAAGCCGAGGACGATATCCGGATTCCAGACGCACCAAACG
CCTGTACGGCTTGGCACGACAGAGAGAGCTGAACTGGGAACGGAGGAGTATATTTCGTTTGCGCATGTGATGGAG
GGATTTGTGATCCTACAAAAGAACCCAGGTTGGGAGAAAGAAGATAAAATGGATGTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail