Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|018780
Gene name
Locationscaffold_10:1015981..1017187
Strand-
Gene length (bp)1206
Transcript length (bp)1206
Coding sequence length (bp)1206
Protein length (aa) 402

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02265 S1-P1_nuclease S1/P1 Nuclease 1.1E-41 24 209

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C9G4|ENDO2_ARATH Endonuclease 2 OS=Arabidopsis thaliana GN=ENDO2 PE=1 SV=1 15 261 1.0E-25
sp|P24021|NUS1_ASPOR Nuclease S1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nucS PE=1 SV=2 21 198 2.0E-21
sp|F4JJL0|ENDO4_ARATH Endonuclease 4 OS=Arabidopsis thaliana GN=ENDO4 PE=3 SV=1 11 228 2.0E-19
sp|Q9SXA6|ENDO1_ARATH Endonuclease 1 OS=Arabidopsis thaliana GN=ENDO1 PE=1 SV=1 4 259 2.0E-19
sp|Q8LDW6|ENDO3_ARATH Endonuclease 3 OS=Arabidopsis thaliana GN=ENDO3 PE=2 SV=1 5 259 4.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C9G4|ENDO2_ARATH Endonuclease 2 OS=Arabidopsis thaliana GN=ENDO2 PE=1 SV=1 15 261 1.0E-25
sp|P24021|NUS1_ASPOR Nuclease S1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nucS PE=1 SV=2 21 198 2.0E-21
sp|F4JJL0|ENDO4_ARATH Endonuclease 4 OS=Arabidopsis thaliana GN=ENDO4 PE=3 SV=1 11 228 2.0E-19
sp|Q9SXA6|ENDO1_ARATH Endonuclease 1 OS=Arabidopsis thaliana GN=ENDO1 PE=1 SV=1 4 259 2.0E-19
sp|Q8LDW6|ENDO3_ARATH Endonuclease 3 OS=Arabidopsis thaliana GN=ENDO3 PE=2 SV=1 5 259 4.0E-18
sp|F4JJL3|ENDO5_ARATH Endonuclease 5 OS=Arabidopsis thaliana GN=ENDO5 PE=2 SV=1 5 259 3.0E-14
sp|P24504|NUP3_PENSQ Nuclease PA3 OS=Penicillium sp. PE=1 SV=1 24 206 3.0E-13
sp|P24289|NUP1_PENCI Nuclease P1 OS=Penicillium citrinum PE=1 SV=1 24 206 4.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0006308 DNA catabolic process Yes
GO:0003676 nucleic acid binding Yes
GO:0004519 endonuclease activity Yes
GO:0071704 organic substance metabolic process No
GO:1901575 organic substance catabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008152 metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0009056 catabolic process No
GO:0008150 biological_process No
GO:1901361 organic cyclic compound catabolic process No
GO:0044248 cellular catabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0005488 binding No
GO:0016787 hydrolase activity No
GO:1901363 heterocyclic compound binding No
GO:0006259 DNA metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0019439 aromatic compound catabolic process No
GO:0044237 cellular metabolic process No
GO:0009057 macromolecule catabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:0003824 catalytic activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0009987 cellular process No
GO:0043170 macromolecule metabolic process No
GO:0044238 primary metabolic process No
GO:0004518 nuclease activity No
GO:0044270 cellular nitrogen compound catabolic process No
GO:0034655 nucleobase-containing compound catabolic process No
GO:0003674 molecular_function No
GO:0046700 heterocycle catabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|018780
MRLTRLQSLAILTGLTTLPSTFAWGAAGHEIVATIAQIYTQPDVLDKICSILNAYDDQIHEDEFSMTTPHKCHLA
SIATWADKLKYRMRWSAPLHYVNAVGDHPSDTCMFPGPEGWSGKPNINVLGGIYNTSNILLEYAQGEDERGMDVG
LAQEALKFIVHFIGDMHMPLHLVGRDKGGNGVEVCWEGRRRKFHSVWDNYIVAKAIRDTGNNYSRPLPGGYEPVE
RHLRGAIYDPYIRRIIWEGVEGRWAEDLDGWLDCPKVDEDARKEAVKKGVFATLGNVFLPGWLTNWGTAETTVTD
TDAICPYHWAKPIHALNCELLWPKEMDEPFNGASAHRRPRCKRWSEEEQREVVDIDEEPPYELDNPDYMTPIQER
MLLEQFLAQGGVRLAGVLNYIFADRI*
Coding >AgabiH97|018780
ATGCGGCTGACCCGTCTACAATCTCTTGCTATCCTAACTGGCTTAACCACCCTACCCAGCACCTTCGCATGGGGA
GCAGCTGGACACGAAATTGTCGCCACTATCGCGCAAATCTACACTCAACCTGACGTGTTAGACAAGATTTGTAGC
ATTCTAAACGCGTACGATGATCAAATTCACGAAGATGAATTCTCTATGACCACACCACATAAATGTCATCTCGCG
TCCATCGCAACTTGGGCAGACAAGTTGAAATATCGGATGCGTTGGTCTGCACCTCTACATTATGTCAATGCTGTT
GGTGATCATCCATCTGATACTTGTATGTTTCCTGGTCCGGAAGGATGGTCAGGAAAACCGAATATCAATGTTTTG
GGAGGGATCTACAATACGTCGAATATCCTTTTGGAGTATGCTCAAGGTGAAGATGAGCGTGGTATGGATGTTGGA
CTTGCTCAAGAAGCGCTCAAGTTCATTGTTCATTTCATCGGTGATATGCATATGCCATTGCATCTCGTTGGAAGA
GATAAAGGAGGAAATGGTGTTGAGGTATGTTGGGAAGGCAGAAGAAGAAAGTTCCATTCGGTATGGGACAATTAT
ATTGTGGCAAAGGCTATACGCGATACCGGGAACAATTATTCGAGACCATTACCTGGAGGATATGAACCAGTGGAA
AGGCATTTGAGGGGAGCGATTTATGATCCCTATATTCGGAGGATCATTTGGGAAGGTGTAGAGGGGAGATGGGCG
GAGGATTTGGATGGGTGGCTTGATTGTCCAAAGGTGGATGAGGACGCCAGGAAGGAAGCCGTCAAGAAGGGAGTT
TTCGCAACGCTTGGAAACGTTTTCCTCCCGGGTTGGCTTACGAACTGGGGTACTGCGGAGACTACGGTGACAGAT
ACGGACGCTATATGCCCATACCATTGGGCAAAGCCCATTCACGCTTTGAATTGTGAACTTTTATGGCCCAAGGAG
ATGGATGAACCATTCAATGGTGCGTCTGCTCATCGCAGGCCGAGGTGCAAGCGGTGGAGTGAGGAAGAGCAAAGG
GAGGTTGTTGATATCGACGAGGAACCTCCCTATGAACTTGATAACCCTGACTATATGACACCTATCCAGGAACGG
ATGCTCCTCGAACAGTTTTTGGCTCAAGGAGGTGTGCGTCTGGCTGGAGTGTTGAATTATATTTTTGCAGACAGG
ATATGA
Transcript >AgabiH97|018780
ATGCGGCTGACCCGTCTACAATCTCTTGCTATCCTAACTGGCTTAACCACCCTACCCAGCACCTTCGCATGGGGA
GCAGCTGGACACGAAATTGTCGCCACTATCGCGCAAATCTACACTCAACCTGACGTGTTAGACAAGATTTGTAGC
ATTCTAAACGCGTACGATGATCAAATTCACGAAGATGAATTCTCTATGACCACACCACATAAATGTCATCTCGCG
TCCATCGCAACTTGGGCAGACAAGTTGAAATATCGGATGCGTTGGTCTGCACCTCTACATTATGTCAATGCTGTT
GGTGATCATCCATCTGATACTTGTATGTTTCCTGGTCCGGAAGGATGGTCAGGAAAACCGAATATCAATGTTTTG
GGAGGGATCTACAATACGTCGAATATCCTTTTGGAGTATGCTCAAGGTGAAGATGAGCGTGGTATGGATGTTGGA
CTTGCTCAAGAAGCGCTCAAGTTCATTGTTCATTTCATCGGTGATATGCATATGCCATTGCATCTCGTTGGAAGA
GATAAAGGAGGAAATGGTGTTGAGGTATGTTGGGAAGGCAGAAGAAGAAAGTTCCATTCGGTATGGGACAATTAT
ATTGTGGCAAAGGCTATACGCGATACCGGGAACAATTATTCGAGACCATTACCTGGAGGATATGAACCAGTGGAA
AGGCATTTGAGGGGAGCGATTTATGATCCCTATATTCGGAGGATCATTTGGGAAGGTGTAGAGGGGAGATGGGCG
GAGGATTTGGATGGGTGGCTTGATTGTCCAAAGGTGGATGAGGACGCCAGGAAGGAAGCCGTCAAGAAGGGAGTT
TTCGCAACGCTTGGAAACGTTTTCCTCCCGGGTTGGCTTACGAACTGGGGTACTGCGGAGACTACGGTGACAGAT
ACGGACGCTATATGCCCATACCATTGGGCAAAGCCCATTCACGCTTTGAATTGTGAACTTTTATGGCCCAAGGAG
ATGGATGAACCATTCAATGGTGCGTCTGCTCATCGCAGGCCGAGGTGCAAGCGGTGGAGTGAGGAAGAGCAAAGG
GAGGTTGTTGATATCGACGAGGAACCTCCCTATGAACTTGATAACCCTGACTATATGACACCTATCCAGGAACGG
ATGCTCCTCGAACAGTTTTTGGCTCAAGGAGGTGTGCGTCTGGCTGGAGTGTTGAATTATATTTTTGCAGACAGG
ATATGA
Gene >AgabiH97|018780
ATGCGGCTGACCCGTCTACAATCTCTTGCTATCCTAACTGGCTTAACCACCCTACCCAGCACCTTCGCATGGGGA
GCAGCTGGACACGAAATTGTCGCCACTATCGCGCAAATCTACACTCAACCTGACGTGTTAGACAAGATTTGTAGC
ATTCTAAACGCGTACGATGATCAAATTCACGAAGATGAATTCTCTATGACCACACCACATAAATGTCATCTCGCG
TCCATCGCAACTTGGGCAGACAAGTTGAAATATCGGATGCGTTGGTCTGCACCTCTACATTATGTCAATGCTGTT
GGTGATCATCCATCTGATACTTGTATGTTTCCTGGTCCGGAAGGATGGTCAGGAAAACCGAATATCAATGTTTTG
GGAGGGATCTACAATACGTCGAATATCCTTTTGGAGTATGCTCAAGGTGAAGATGAGCGTGGTATGGATGTTGGA
CTTGCTCAAGAAGCGCTCAAGTTCATTGTTCATTTCATCGGTGATATGCATATGCCATTGCATCTCGTTGGAAGA
GATAAAGGAGGAAATGGTGTTGAGGTATGTTGGGAAGGCAGAAGAAGAAAGTTCCATTCGGTATGGGACAATTAT
ATTGTGGCAAAGGCTATACGCGATACCGGGAACAATTATTCGAGACCATTACCTGGAGGATATGAACCAGTGGAA
AGGCATTTGAGGGGAGCGATTTATGATCCCTATATTCGGAGGATCATTTGGGAAGGTGTAGAGGGGAGATGGGCG
GAGGATTTGGATGGGTGGCTTGATTGTCCAAAGGTGGATGAGGACGCCAGGAAGGAAGCCGTCAAGAAGGGAGTT
TTCGCAACGCTTGGAAACGTTTTCCTCCCGGGTTGGCTTACGAACTGGGGTACTGCGGAGACTACGGTGACAGAT
ACGGACGCTATATGCCCATACCATTGGGCAAAGCCCATTCACGCTTTGAATTGTGAACTTTTATGGCCCAAGGAG
ATGGATGAACCATTCAATGGTGCGTCTGCTCATCGCAGGCCGAGGTGCAAGCGGTGGAGTGAGGAAGAGCAAAGG
GAGGTTGTTGATATCGACGAGGAACCTCCCTATGAACTTGATAACCCTGACTATATGACACCTATCCAGGAACGG
ATGCTCCTCGAACAGTTTTTGGCTCAAGGAGGTGTGCGTCTGGCTGGAGTGTTGAATTATATTTTTGCAGACAGG
ATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail