Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|018630
Gene name
Locationscaffold_10:990418..993013
Strand-
Gene length (bp)2595
Transcript length (bp)1599
Coding sequence length (bp)1599
Protein length (aa) 533

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.9E-27 107 481

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 54 531 1.0E-15
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 11 480 1.0E-12
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 28 270 2.0E-12
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 3 471 6.0E-11
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 44 420 6.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 54 531 1.0E-15
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 11 480 1.0E-12
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 28 270 2.0E-12
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 3 471 6.0E-11
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 44 420 6.0E-11
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 72 441 3.0E-10
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 42 270 5.0E-10
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 5 411 7.0E-10
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 60 470 2.0E-09
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 61 389 2.0E-09
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 23 267 1.0E-08
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 82 275 6.0E-08
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 1 272 2.0E-07
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 57 273 4.0E-07
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 11 528 6.0E-07
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 76 457 2.0E-06
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 76 457 2.0E-06
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 2 264 3.0E-06
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 2 485 3.0E-06
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 2 273 8.0E-06
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 1 316 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

Domain # Start End Length
1 90 112 22
2 127 146 19
3 153 175 22
4 179 201 22
5 214 236 22
6 241 263 22
7 324 346 22
8 361 383 22
9 403 425 22
10 435 457 22
11 469 491 22
12 496 518 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|018630
MSHAKSLSLPNEKHELESDVASEIDLLAFHEEHAGRLIIDPEEAKIELGEAVAAKLKLTKDGKTVLWPQPTDSEN
DPQNWSSRRKHLQLLIVTLAAIVPDFDSGIGIASLFPLAAQYDTTVDEINNLTSNWSIFLLGWGGLVAVMIIRRY
GRLPVLFWSQLLAAAFLVGCTFAPTLKVFTAMRCLTAFFGTAPQVTGLYVVTDLFPFHLQARKLNLWTMGFIISP
FLSPFLFGFLVARTTWRWAYGIGSLYGLLVILLIVFYGEETMYDRTVRPIPELPMKGLGRRIETLIGITGWKMAK
YRTSWKESIMSPLDVVWRPHLMMILWFEAMLFGFGIGINVTNAVFLGEPISEGGYGFSQFGIAGSYATPIVAVII
GELIGRYLNDWIMRISIRRNKGVFEAESRLWACYFAMPLYLCGFLALGGSIEHHLNIGGLIMGWGIAETSIMINT
VAVYAYANDCFPKHQGEISALINLARTLGGFSVAYFQVPWAKKHGAIQTFGCEAAIVIGLFFLVVPVLQIYGTRL
RARYSLH*
Coding >AgabiH97|018630
ATGTCCCATGCGAAGTCCCTTTCCCTTCCTAACGAGAAACATGAGTTGGAATCCGACGTTGCTTCAGAGATCGAC
CTGCTAGCCTTCCACGAAGAGCATGCAGGACGTCTTATCATTGATCCAGAAGAGGCCAAGATTGAGCTTGGAGAG
GCTGTTGCGGCAAAACTGAAGCTCACAAAAGACGGGAAAACGGTTCTTTGGCCCCAACCAACTGACTCGGAAAAC
GACCCTCAGAATTGGTCGTCGCGTCGCAAGCACCTTCAGCTCCTCATAGTGACCTTGGCAGCCATTGTTCCTGAT
TTTGACTCTGGTATCGGGATCGCATCTCTGTTTCCATTAGCTGCCCAATATGATACGACGGTGGATGAGATCAAT
AACTTGACATCGAACTGGAGCATTTTTTTGTTGGGCTGGGGAGGACTCGTTGCGGTAATGATTATTAGGCGATAT
GGCCGCCTACCTGTCTTGTTCTGGTCTCAACTCCTTGCGGCTGCTTTCCTCGTCGGGTGTACGTTCGCCCCGACT
CTCAAAGTCTTTACTGCAATGCGATGCTTGACTGCTTTCTTTGGGACGGCTCCTCAGGTGACTGGGCTATACGTT
GTCACAGATTTGTTCCCCTTCCATCTTCAAGCTCGGAAACTGAATCTATGGACCATGGGTTTCATTATCTCCCCG
TTCTTGTCTCCGTTTCTCTTTGGTTTCCTAGTAGCTCGGACGACTTGGAGGTGGGCGTACGGAATTGGATCTCTC
TACGGACTCTTAGTGATTTTGCTCATCGTGTTCTATGGTGAAGAGACGATGTATGACCGGACAGTCAGGCCGATA
CCTGAATTACCGATGAAGGGTCTTGGACGTAGAATCGAGACGTTGATTGGAATTACCGGCTGGAAAATGGCAAAG
TATCGTACGTCATGGAAAGAGTCGATTATGTCTCCCTTGGATGTAGTGTGGAGACCTCATTTGATGATGATCCTT
TGGTTTGAGGCAATGTTATTTGGCTTTGGAATTGGTATCAATGTTACCAATGCTGTATTTTTGGGTGAACCGATA
TCAGAGGGAGGATACGGATTCAGTCAGTTTGGGATTGCAGGTAGCTATGCGACTCCCATAGTGGCCGTCATAATC
GGAGAACTTATTGGTCGGTATCTCAACGATTGGATCATGAGAATTAGTATCCGTCGGAACAAAGGTGTCTTTGAA
GCTGAAAGTCGTCTATGGGCCTGTTATTTCGCGATGCCATTGTACCTTTGTGGATTCTTAGCCCTCGGGGGATCG
ATTGAACATCATCTGAATATTGGTGGCTTGATAATGGGTTGGGGAATTGCTGAGACTTCTATTATGATCAATACT
GTGGCTGTATACGCATATGCCAATGATTGTTTCCCCAAACACCAGGGCGAAATCAGTGCCCTGATTAATTTAGCG
AGAACGTTGGGGGGTTTCAGTGTTGCATATTTCCAAGTGCCGTGGGCAAAGAAGCATGGCGCCATTCAGACGTTC
GGCTGTGAAGCAGCAATCGTGATAGGATTATTTTTCTTAGTAGTGCCTGTACTACAAATTTATGGCACGAGATTG
AGGGCGCGGTATTCTCTGCATTAG
Transcript >AgabiH97|018630
ATGTCCCATGCGAAGTCCCTTTCCCTTCCTAACGAGAAACATGAGTTGGAATCCGACGTTGCTTCAGAGATCGAC
CTGCTAGCCTTCCACGAAGAGCATGCAGGACGTCTTATCATTGATCCAGAAGAGGCCAAGATTGAGCTTGGAGAG
GCTGTTGCGGCAAAACTGAAGCTCACAAAAGACGGGAAAACGGTTCTTTGGCCCCAACCAACTGACTCGGAAAAC
GACCCTCAGAATTGGTCGTCGCGTCGCAAGCACCTTCAGCTCCTCATAGTGACCTTGGCAGCCATTGTTCCTGAT
TTTGACTCTGGTATCGGGATCGCATCTCTGTTTCCATTAGCTGCCCAATATGATACGACGGTGGATGAGATCAAT
AACTTGACATCGAACTGGAGCATTTTTTTGTTGGGCTGGGGAGGACTCGTTGCGGTAATGATTATTAGGCGATAT
GGCCGCCTACCTGTCTTGTTCTGGTCTCAACTCCTTGCGGCTGCTTTCCTCGTCGGGTGTACGTTCGCCCCGACT
CTCAAAGTCTTTACTGCAATGCGATGCTTGACTGCTTTCTTTGGGACGGCTCCTCAGGTGACTGGGCTATACGTT
GTCACAGATTTGTTCCCCTTCCATCTTCAAGCTCGGAAACTGAATCTATGGACCATGGGTTTCATTATCTCCCCG
TTCTTGTCTCCGTTTCTCTTTGGTTTCCTAGTAGCTCGGACGACTTGGAGGTGGGCGTACGGAATTGGATCTCTC
TACGGACTCTTAGTGATTTTGCTCATCGTGTTCTATGGTGAAGAGACGATGTATGACCGGACAGTCAGGCCGATA
CCTGAATTACCGATGAAGGGTCTTGGACGTAGAATCGAGACGTTGATTGGAATTACCGGCTGGAAAATGGCAAAG
TATCGTACGTCATGGAAAGAGTCGATTATGTCTCCCTTGGATGTAGTGTGGAGACCTCATTTGATGATGATCCTT
TGGTTTGAGGCAATGTTATTTGGCTTTGGAATTGGTATCAATGTTACCAATGCTGTATTTTTGGGTGAACCGATA
TCAGAGGGAGGATACGGATTCAGTCAGTTTGGGATTGCAGGTAGCTATGCGACTCCCATAGTGGCCGTCATAATC
GGAGAACTTATTGGTCGGTATCTCAACGATTGGATCATGAGAATTAGTATCCGTCGGAACAAAGGTGTCTTTGAA
GCTGAAAGTCGTCTATGGGCCTGTTATTTCGCGATGCCATTGTACCTTTGTGGATTCTTAGCCCTCGGGGGATCG
ATTGAACATCATCTGAATATTGGTGGCTTGATAATGGGTTGGGGAATTGCTGAGACTTCTATTATGATCAATACT
GTGGCTGTATACGCATATGCCAATGATTGTTTCCCCAAACACCAGGGCGAAATCAGTGCCCTGATTAATTTAGCG
AGAACGTTGGGGGGTTTCAGTGTTGCATATTTCCAAGTGCCGTGGGCAAAGAAGCATGGCGCCATTCAGACGTTC
GGCTGTGAAGCAGCAATCGTGATAGGATTATTTTTCTTAGTAGTGCCTGTACTACAAATTTATGGCACGAGATTG
AGGGCGCGGTATTCTCTGCATTAG
Gene >AgabiH97|018630
ATGTCCCATGCGAAGTCCCTTTCCCTTCCTAACGAGAAACATGAGTTGGAATCCGACGTTGCTTCAGAGATCGAC
CTGCTAGCCTTCCACGAAGAGCATGCAGGACGTCTTATCATTGATCCAGAGTGTGTGGTTCACTCATCTGCTTGC
TGATAATTTGACTGGATCTGAACGGAATTTCATAGAGAGGCCAAGATTGAGCTTGGAGAGGCTGTTGCGGCAAAA
CTGAAGCTCACAAAAGACGGGAAAACGGTTCTTTGGCCCCAACCAACTGACTCGGAAAACGACCCTCAGAATTGG
TCGTCGCGTCGCAAGCACCTTCAGCTCCTCATAGTGACCTTGGCAGCCATTGTTCCTGATTTTGACTCTGGTATC
GGTACGCGATGGCCTGTTCGTACTGAAAACGAAGATTCTAATGTCGTTTCGACGTTCAAAGGGATCGCATCTCTG
TTTCCATTAGCTGCCCAATATGATACGACGGTGGATGAGATCAATAACTTGACATCGAAGTAGGTGTTCAACGTG
TTTCTGAAATTTCTCACTGCTCACGTCTTTCCAAGCTGGAGCATTTTTTTGTTGGGTACGGTTTGATTACGTTGT
GCGAACGATGGCTCATGCTTGTCTCTGCTTCCCAACAGGCTGGGGAGGACTCGTTGCGGTAATGATTATTAGGCG
ATATGGCCGCCTACCTGTCTTGTTCTGGTCTCAAGTATGTTTATGTTTCTTTCGAACCTCATGACTTATTTCATC
ATCAATAACCTGCATTTAGCTCCTTGCGGCTGCTTTCCTCGTCGGGTGTACGTTCGCCCCGACTCTCAAAGTCTT
TACTGGTAAACTATTTCGTTGTTATCACCAAATCCCTGCTCACTATAATGTTATAGCAATGCGATGCTTGACTGC
TTTCTTTGGGTAGCTTATCTTTTTTTTTCCGCCGTCAAGTGACCTAGATACTTATCATTTTATGTTAGGACGGCT
CCTCAGGTGACTGTAAGCTAATGTTTATTTTACTTTCACACTGCAGAAGGTTCAAATTACTTTAAGGGGCTATAC
GTTGTCACAGATTTGTTCCCCTTCCATCTTCAAGCTCGGAAAGTAAGTCGTTGATTATAAAGTGCGATACGATGA
ATGCCAACAATCTACATTCACAGCTGAATCTATGGACCATGGGTTTCATTATCTCCCCGTTCTTGTCTCCGTTTC
TCTTTGGTTTCCTAGTAGCTCGGACGACTTGGAGGTGGGCGTACGGAATTGGATCTCTCTACGGACTCTTAGTGA
TTTTGCTCATCGTGTTCTATGGTGAAGAGACGTAAGCGTTCCTGTTTGTGGGGTTTGAAGCTAATCTCAGACGGG
TCATTCCAGGATGTATGACCGGACAGTCAGGCCGATACCTGAATTACCGATGAAGGGTCTTGGACGTAGAATCGA
GACGTTGATTGGAATTACCGGCTGGAAAATGGCAAAGTATCGTACGTCATGGAAAGAGTCGATTATGTCTCCCTT
GGATGTAGTGTGGAGACCTCATTTGATGATGATCCTTTGGTTTGAGGTAAGTGTCTGTGTTTCTGTTAGCGAGGT
TGCACACTCAATTCCTATCTTCAGGCAATGTTATTTGGCTTTGGAATTGGTATCAATGTAAGGTGTTCAAATTGA
ATTGCTCCGTCTATGGTTGATAACCTCAACACGTAGGTTACCAATGCTGTATTTTTGGGTGAACCGATATCAGAG
GGAGGATACGGATTCAGTCAGTTTGGGATTGCAGGTAGCTATGCGACTCCCATAGTGTGTAACATTCCATCCCCC
TCGCCTGTTATATCCCATTGATTGTCTTCAGGTGGCCGTCATAATCGGAGAACTTATTGGTCGGTATCTCAACGA
TTGGATCATGAGAATTAGTATCCGTCGGAACAAAGGTGTCTTTGAAGCTGAAAGTCGTCTATGGTGCGTCGTCGT
CATCTGTCATCTCAGTGGGTTGTAAATAATACTCCTATCCAGGGCCTGTTATTTCGCGATGCCATTGTACCTTTG
TGGATTCTTAGCCCTCGGGGGATCGATTGAACATCATCTGAATATTGGTGGCTTGATAATGGGTTGGGGAATTGC
TGAGACTTCTATTATGATCAATACTGTGGCTGTATACGCATATGCCAATGATTGTTTCCCCAAACACCAGGTGCG
TACCTTTCGCTAAAATTGTCTGAAACATTGGTAAACTTGGGAACCAGGGCGAAATCAGTGCCCTGATTAATTTAG
CGAGAACGTTGGGGGGTACGTACCTTGACTACATATTTGACTGCACGTTTATGACTGTGACTGGCGGATCTCAGG
TTTCAGTGTTGCATATTTCCAAGTGCCGTGGGCAAAGAAGCATGGCGCCATTCAGACGTTCGGCTGTGAAGCAGC
GTAAGCCGTTACTGCTGATTATGCAATTGAACGATGCTCACCTGGTTAATACCTCAGAATCGTGATAGGATTATT
TTTCTTAGTAGTGCCTGTACTACAAATTTATGGCACGAGATTGAGGGTATGTGTTTTCATAATTTTTATTATTTG
TACCGCCTCTAATCAACCATAAAGGCGCGGTATTCTCTGCATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail