Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|018600
Gene name
Locationscaffold_10:982942..986083
Strand+
Gene length (bp)3141
Transcript length (bp)1947
Coding sequence length (bp)1947
Protein length (aa) 649

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06964 Alpha-L-AF_C Alpha-L-arabinofuranosidase C-terminal domain 7.9E-37 450 639

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0CTV2|ABFA_ASPTN Probable alpha-L-arabinofuranosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=abfA PE=3 SV=1 8 644 2.0E-141
sp|B8NKA3|ABFA_ASPFN Probable alpha-L-arabinofuranosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=abfA PE=3 SV=2 1 643 1.0E-140
sp|Q2U790|ABFA_ASPOR Probable alpha-L-arabinofuranosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=abfA PE=3 SV=2 1 643 3.0E-140
sp|Q96X54|ABFA_ASPAW Probable alpha-L-arabinofuranosidase A OS=Aspergillus awamori GN=abfA PE=1 SV=1 5 643 4.0E-133
sp|Q8NK90|ABFA_ASPKW Alpha-L-arabinofuranosidase A OS=Aspergillus kawachii (strain NBRC 4308) GN=abfA PE=1 SV=2 5 643 4.0E-133
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0CTV2|ABFA_ASPTN Probable alpha-L-arabinofuranosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=abfA PE=3 SV=1 8 644 2.0E-141
sp|B8NKA3|ABFA_ASPFN Probable alpha-L-arabinofuranosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=abfA PE=3 SV=2 1 643 1.0E-140
sp|Q2U790|ABFA_ASPOR Probable alpha-L-arabinofuranosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=abfA PE=3 SV=2 1 643 3.0E-140
sp|Q96X54|ABFA_ASPAW Probable alpha-L-arabinofuranosidase A OS=Aspergillus awamori GN=abfA PE=1 SV=1 5 643 4.0E-133
sp|Q8NK90|ABFA_ASPKW Alpha-L-arabinofuranosidase A OS=Aspergillus kawachii (strain NBRC 4308) GN=abfA PE=1 SV=2 5 643 4.0E-133
sp|P42254|ABFA_ASPNG Alpha-L-arabinofuranosidase A OS=Aspergillus niger GN=abfA PE=1 SV=1 5 643 2.0E-132
sp|A2Q7E0|ABFA_ASPNC Probable alpha-L-arabinofuranosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=abfA PE=3 SV=1 5 643 4.0E-132
sp|U6A629|ABFA_PENCN Alpha-L-arabinofuranosidase A OS=Penicillium canescens GN=abfA PE=1 SV=1 23 644 5.0E-125
sp|Q8VZR2|ASD2_ARATH Alpha-L-arabinofuranosidase 2 OS=Arabidopsis thaliana GN=ASD2 PE=2 SV=1 6 626 2.0E-84
sp|Q5BA89|ABFA_EMENI Probable alpha-L-arabinofuranosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=abfA PE=3 SV=1 95 644 1.0E-79
sp|Q9SG80|ASD1_ARATH Alpha-L-arabinofuranosidase 1 OS=Arabidopsis thaliana GN=ASD1 PE=1 SV=1 6 626 7.0E-76
sp|P82593|EABF_STRCX Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces chartreusis PE=1 SV=1 37 557 1.0E-63
sp|Q4WTB3|ABFC_ASPFU Probable alpha-L-arabinofuranosidase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=abfC PE=3 SV=2 230 402 7.0E-11
sp|B0XQB2|ABFC_ASPFC Probable alpha-L-arabinofuranosidase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=abfC PE=3 SV=2 230 402 7.0E-11
sp|Q5BDV3|ABFC_EMENI Alpha-L-arabinofuranosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=abfC PE=2 SV=1 230 402 1.0E-10
sp|B8NIX4|ABFC_ASPFN Probable alpha-L-arabinofuranosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=abfC PE=3 SV=1 230 402 7.0E-10
sp|A3DIH0|IABF_CLOTH Intracellular exo-alpha-(1->5)-L-arabinofuranosidase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=Cthe_2548 PE=1 SV=1 222 373 1.0E-07
sp|Q59219|IABF_BACOV Intracellular exo-alpha-L-arabinofuranosidase OS=Bacteroides ovatus GN=asdII PE=3 SV=1 230 645 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0046556 alpha-L-arabinofuranosidase activity Yes
GO:0046373 L-arabinose metabolic process Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0019566 arabinose metabolic process No
GO:0005975 carbohydrate metabolic process No
GO:0019321 pentose metabolic process No
GO:0044281 small molecule metabolic process No
GO:0005996 monosaccharide metabolic process No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|018600
MLKLALLGVSALLGIVGLVDAQSSVTVNVERTASHPIPSTLWGYMISASHSGDGGLYAELIQNRAFQQVSPGSSS
ALNAWQAVNGASLRVIRESVPVSSALPNALQVDFPNGRSGGVGFANTGFGGIKVTSGTTYTGSFFYRFSSSSGFQ
GSATVSLQSSSGSTLGSTTVNLSGSQTSWRKLTFSIRASSTPGNTNNRFVVTLDGGSAGGQSIHFTMLSLFPPTF
KNRPNGMRVDIATTLAEMGPSFWRFPGGNNLEGQTVATRWQWNATVGPMETRPGRQGDWGYVNSDGLGILEYLHW
CEDLNVEPIMGVWAGFALGGTSVPENQLQPFIDQAVDQINFVIGDSSTGPGALRASLGHPEPFNLRFVEIGNEDF
FGASTYVYRWRNFVNALKNRFPQLHFIATTNVNDPNLNPKPTEYDVHVYQTPTWFAENSFFYDNFARDGTKYFEG
EYAAISTNPNDIFGSPANGRLVFPTMQSAAGEAAFMTGLERNSDIVFAAAYAPMLGDVNNHQWTPNLVGFDAGNV
YRSTSFYVQKLFSLNRGDEYLPSTLPSRTGTLHWSVVRKTSNNQIIIKVSNTGGSTSRLTFNLPFNNVATSGTAQ
VLTGSGTSSNTPNNPNLITPQSRNIQTGRSFTFDAPAVSVSVLTFTAS*
Coding >AgabiH97|018600
ATGCTTAAACTTGCGTTGTTAGGCGTGTCCGCATTATTGGGGATAGTTGGGCTGGTTGATGCTCAATCTTCGGTG
ACGGTGAATGTCGAAAGGACAGCTAGTCATCCAATCCCATCGACCCTTTGGGGTTATATGATATCAGCGTCACAT
AGTGGTGATGGTGGTCTCTATGCCGAGTTAATTCAAAACAGAGCATTCCAGCAAGTCAGCCCTGGATCCAGCTCA
GCTCTAAATGCATGGCAAGCTGTCAATGGAGCGAGTCTGAGGGTCATCCGAGAGTCCGTTCCGGTATCTTCTGCT
CTACCCAACGCCCTTCAAGTTGACTTTCCAAATGGACGCTCCGGGGGAGTTGGATTCGCTAACACGGGCTTTGGT
GGCATCAAGGTTACTTCTGGAACGACTTATACTGGTTCTTTCTTTTATCGTTTCTCCAGCTCTTCCGGATTCCAA
GGTAGCGCCACTGTGTCTTTGCAGTCATCTTCTGGGTCAACGCTCGGCAGCACCACTGTGAACTTGTCTGGTTCT
CAGACATCCTGGCGCAAATTGACGTTCAGTATCCGCGCGTCCAGTACTCCCGGCAATACAAATAATCGTTTCGTC
GTTACGTTAGATGGTGGGAGCGCCGGTGGTCAAAGCATCCATTTCACAATGTTGTCATTGTTCCCGCCGACGTTC
AAAAATCGTCCGAATGGCATGAGAGTCGATATTGCGACGACATTGGCGGAAATGGGACCGTCGTTTTGGAGGTTC
CCTGGAGGTAATAACTTGGAGGGTCAGACGGTCGCTACGAGGTGGCAGTGGAATGCTACAGTTGGGCCTATGGAA
ACCCGCCCAGGACGACAGGGTGACTGGGGCTATGTGAATTCCGATGGTTTGGGTATCCTTGAATACCTTCATTGG
TGCGAAGACCTAAATGTGGAGCCGATCATGGGTGTTTGGGCAGGGTTTGCACTTGGGGGAACAAGCGTACCTGAA
AACCAACTGCAACCTTTCATTGACCAGGCAGTTGATCAGATCAACTTTGTCATTGGTGATAGCAGTACCGGACCA
GGTGCTTTGAGAGCCTCCCTCGGACACCCAGAACCATTTAATTTGAGATTCGTAGAAATCGGAAACGAGGACTTC
TTTGGAGCTTCTACCTACGTATACCGTTGGCGTAACTTTGTCAATGCTCTCAAGAACCGCTTCCCACAACTCCAT
TTTATCGCCACTACTAACGTCAATGATCCGAACCTCAACCCGAAACCGACAGAGTATGACGTACACGTCTACCAA
ACTCCCACTTGGTTTGCTGAAAATTCATTCTTTTATGATAACTTCGCGAGGGATGGGACCAAGTATTTTGAGGGT
GAGTATGCGGCCATCTCGACCAACCCTAACGATATCTTCGGGTCCCCTGCCAATGGTCGTCTTGTTTTCCCAACG
ATGCAAAGTGCTGCTGGGGAGGCTGCTTTCATGACCGGATTGGAAAGAAATAGTGACATTGTGTTCGCTGCTGCG
TATGCCCCTATGCTCGGTGACGTGAATAATCATCAATGGACCCCGAACTTGGTTGGATTTGATGCAGGAAATGTC
TACCGATCGACAAGTTTCTATGTCCAAAAACTGTTCAGTCTGAACCGCGGTGATGAATATCTCCCGAGTACCCTT
CCCTCTCGTACTGGTACACTTCACTGGAGTGTTGTTCGCAAGACATCAAACAATCAAATTATAATCAAGGTATCC
AATACCGGTGGTAGTACCTCTCGCCTTACTTTCAATTTACCCTTCAACAACGTCGCAACAAGTGGGACTGCACAG
GTTTTGACTGGATCCGGGACTTCTAGTAACACTCCCAACAACCCCAATCTCATCACGCCTCAGAGTAGGAATATC
CAGACTGGCCGATCATTCACCTTCGACGCACCAGCAGTCAGTGTGAGCGTTTTGACATTTACGGCTTCGTGA
Transcript >AgabiH97|018600
ATGCTTAAACTTGCGTTGTTAGGCGTGTCCGCATTATTGGGGATAGTTGGGCTGGTTGATGCTCAATCTTCGGTG
ACGGTGAATGTCGAAAGGACAGCTAGTCATCCAATCCCATCGACCCTTTGGGGTTATATGATATCAGCGTCACAT
AGTGGTGATGGTGGTCTCTATGCCGAGTTAATTCAAAACAGAGCATTCCAGCAAGTCAGCCCTGGATCCAGCTCA
GCTCTAAATGCATGGCAAGCTGTCAATGGAGCGAGTCTGAGGGTCATCCGAGAGTCCGTTCCGGTATCTTCTGCT
CTACCCAACGCCCTTCAAGTTGACTTTCCAAATGGACGCTCCGGGGGAGTTGGATTCGCTAACACGGGCTTTGGT
GGCATCAAGGTTACTTCTGGAACGACTTATACTGGTTCTTTCTTTTATCGTTTCTCCAGCTCTTCCGGATTCCAA
GGTAGCGCCACTGTGTCTTTGCAGTCATCTTCTGGGTCAACGCTCGGCAGCACCACTGTGAACTTGTCTGGTTCT
CAGACATCCTGGCGCAAATTGACGTTCAGTATCCGCGCGTCCAGTACTCCCGGCAATACAAATAATCGTTTCGTC
GTTACGTTAGATGGTGGGAGCGCCGGTGGTCAAAGCATCCATTTCACAATGTTGTCATTGTTCCCGCCGACGTTC
AAAAATCGTCCGAATGGCATGAGAGTCGATATTGCGACGACATTGGCGGAAATGGGACCGTCGTTTTGGAGGTTC
CCTGGAGGTAATAACTTGGAGGGTCAGACGGTCGCTACGAGGTGGCAGTGGAATGCTACAGTTGGGCCTATGGAA
ACCCGCCCAGGACGACAGGGTGACTGGGGCTATGTGAATTCCGATGGTTTGGGTATCCTTGAATACCTTCATTGG
TGCGAAGACCTAAATGTGGAGCCGATCATGGGTGTTTGGGCAGGGTTTGCACTTGGGGGAACAAGCGTACCTGAA
AACCAACTGCAACCTTTCATTGACCAGGCAGTTGATCAGATCAACTTTGTCATTGGTGATAGCAGTACCGGACCA
GGTGCTTTGAGAGCCTCCCTCGGACACCCAGAACCATTTAATTTGAGATTCGTAGAAATCGGAAACGAGGACTTC
TTTGGAGCTTCTACCTACGTATACCGTTGGCGTAACTTTGTCAATGCTCTCAAGAACCGCTTCCCACAACTCCAT
TTTATCGCCACTACTAACGTCAATGATCCGAACCTCAACCCGAAACCGACAGAGTATGACGTACACGTCTACCAA
ACTCCCACTTGGTTTGCTGAAAATTCATTCTTTTATGATAACTTCGCGAGGGATGGGACCAAGTATTTTGAGGGT
GAGTATGCGGCCATCTCGACCAACCCTAACGATATCTTCGGGTCCCCTGCCAATGGTCGTCTTGTTTTCCCAACG
ATGCAAAGTGCTGCTGGGGAGGCTGCTTTCATGACCGGATTGGAAAGAAATAGTGACATTGTGTTCGCTGCTGCG
TATGCCCCTATGCTCGGTGACGTGAATAATCATCAATGGACCCCGAACTTGGTTGGATTTGATGCAGGAAATGTC
TACCGATCGACAAGTTTCTATGTCCAAAAACTGTTCAGTCTGAACCGCGGTGATGAATATCTCCCGAGTACCCTT
CCCTCTCGTACTGGTACACTTCACTGGAGTGTTGTTCGCAAGACATCAAACAATCAAATTATAATCAAGGTATCC
AATACCGGTGGTAGTACCTCTCGCCTTACTTTCAATTTACCCTTCAACAACGTCGCAACAAGTGGGACTGCACAG
GTTTTGACTGGATCCGGGACTTCTAGTAACACTCCCAACAACCCCAATCTCATCACGCCTCAGAGTAGGAATATC
CAGACTGGCCGATCATTCACCTTCGACGCACCAGCAGTCAGTGTGAGCGTTTTGACATTTACGGCTTCGTGA
Gene >AgabiH97|018600
ATGCTTAAACTTGCGTTGTTAGGCGTGTCCGCATTATTGGGGATAGTTGGGCTGGTTGATGCTCAATCTTCGGTG
ACGGTGAATGTCGAAAGGACAGCTAGTCATCCAATCCCATCGACCCTTTGTAAGTCCTTGAATTCATCATCTTTA
CTTGTATGGCTGATCTCTTGACGCAGGGGGTTATATGTATGAGGCGAGTCGGGCTCAATACCATTGACAATTATC
ATTTTTCTAATTGCGAAGCTTCAAATTTTGTAGGATATCAGCGTCAGTGATATTCACTTTCTTCTCTTTATGACT
GTTTTACTCAATTTCAGTTTCTGCTTATAGCATGTGAGTCATTTCACGATCAGCTTAGAATGCTATTCATGAGTT
TCACTGCAGAGTGGTGATGGTGGTCTCTATGCCGAGTGTAAGGAGCAACGTTATAATTGATTTACCTTGTAAAAC
TCACGAAGCATTTGTAGTAATTCAAAACAGAGCATTCCAGCAAGTCAGCCCTGGATCCAGCTCAGCTCTAAATGC
ATGGCAAGCTGTCAATGGAGCGAGTCTGAGGGTCATCCGAGAGTCCGTTCCGGTATCTTCTGCTCTACCCAACGC
CCTTCAAGTTGACTTTCCAAATGGACGCTCCGGGGGAGTTGGATTCGCTAACACGGGCTTTGGTGGTATATCTTA
TCCTTGCCTACTATTCAAGCAACGACTCATCGTAGACTGATCTGCCAGGCATCAAGGTTACTTCTGGAACGACTT
ATACTGGTTCTTTCTTTTATCGTTTCTCCAGCTCTTCCGGATTCCAAGGTAGCGCCACTGTGTCTTTGCAGTCAT
CTTCTGGGTCAACGCTCGGCAGCACCACTGTGAACTTGTCTGGTTCTCAGACATCCTGGCGCAAATTGACGTTCA
GTATCCGCGCGTCCAGTACTCCCGGCAATACAAATAATCGTTTCGTCGTTACGTTAGATGGTGGGAGCGCCGGTG
GTCAAAGCATCCATTTCACAATGTTGTCATTGTTCCCGCCGACGTTCAAAAATCGTCCGAATGGCATGAGAGTCG
ATATTGCGACGACATTGGCGGAAATGGGACCGTCGTTTTGGAGGTTCCCTGGAGGTAATAACTTGGAGGGTCAGA
CGGTCGCTACGAGGTGGCAGTGGAATGCTACAGTTGGGCCTATGGAAACCCGCCCAGGTACATATATTTCAAGGA
CTCAACGTCTGAGTGCGTCACACTGAAAGCCAACTTCTACAGGACGACAGGGTGACTGGGGCTATGTGAATTCCG
AGTGCGTGTCGAATTTGATTAGGGATGCTTGATGGTTTATGGTTGTCGTTACTGCAGTGGTTTGGGTATCCTTGA
ATACCTTCATTGGTGCGAAGACCTAAATGTGGAGCCGATCATGGGTGTTTGGGCAGGTAAATTATAAAAGCGCTA
AATCCACCCGATATTCACTTCATGTAACAGGGTTTGCACTTGGGGGAACAAGCGTACCTGAAAACCAACTGCAAC
CTTTCATTGACCAGGCAGTTGATCAGGCAAGTATCTACGCTGACTAAAAGAAAAATTACTTACAGCCTCATTTAG
ATCAACTTTGTCATTGGTGATAGCAGTACCGGACCAGGTATGCGAGGAGCTACATAAGAAAACCTTTGAATTGAT
CAGCGATGCCTCCAGGTGCTTTGAGAGCCTCCCTCGGACACCCAGAACCATTTAATTTGAGATTCGTAGAAATCG
GAAACGAGGTACGTACATTCAGTTAGCTTGAAAAAAAGAGGAAAGTGCTCACCAGGTCCTAGGACTTCTTTGGAG
CTTCTACCTACGTATACCGTTGGCGTAACTTTGTCAATGCTCTCAAGAACCGCTTCCCACAACTCCGTGCGCTCT
TTTACAAGTTGCATTGCTGTCTTTCCTGACAGATGAGTCTGCAGATTTTATCGCCACTACTAACGTCAATGATCC
GAACCTCAACCCGAAACCGACAGAGTATGACGTACACGTCTACCAAACTCCCAGTCAGTTCCATTTCAATCAAAG
GGTGTCGCTGACGTTGACAAATTCTGCTATCAAGCTTGGTTTGCTGAAAATTCATTCTTTTATGATAACTTCGCG
GTATGTGCTTGTGACTAGGAATGTTACTATTTCTGAAGATCATCGATTCCAGAGGGATGGGACCAAGTATTTTGA
GGCGAGCCGAATTCAATGATTTCAAGCTGTAGCACTGATAACCGTATTCCTAGGGTGAGTATGCGGCCATCTCGA
CCAACCCTAACGATATCTTCGGGTCCCCTGCCAATGGTCGTCTTGTTTTCCCAACGATGCAAAGTACGTCATTCG
ATATTATATATGATTTTGGAAACTGATATCAATTACCAGGTGCTGCTGGGGAGGCTGCTTTCATGACCGGATTGG
AAAGAAATAGTGACATTGTGTAAGTGCGACTCGTGCACTTTGCGATGAATGTCTCTGAAAATTCATGATACTGCT
AGGTTCGCTGCTGCGTATGCCCCTATGCTCGGTGTAAGTACCTAGTGGCGTTCTAAACTCAAATTTTGACGAGAA
CTTTGCAGGACGTGAATAATCATCAATGGGTTTGTTTTCACATTCAGGTATTGTGTACATGATCTCTGATCCAAC
TTTTTAGACCCCGAACTTGGTTGGATTTGAGTGAGTTGTTGAGCAAATAACCCAACGATGTGTTTCTGACAACAA
GCAGTGCAGGAAATGTCTACCGATCGACAAGTTTCTATGTCCAAAAACTGTTCAGTCTGAACCGCGGTGATGAAT
ATCTCCCGAGTACCCTTCCCTCTCGTACTGGTACACTTCACTGGAGTGTTGTTCGCAAGACATCAAACAATCAAA
TTATAATCAAGGTGAGCCCTTCCACTCAAATTCTTGAACCTGTTGTAAACACCCGTTGCGTAGGTATCCAATACC
GGTGGTAGTACCTCTCGCCTTACTTTCAATTTACCCTTCAACAACGTCGCAACAAGTGGGACTGCACAGGTTTTG
ACTGGATCCGGGACTTCTAGTAACACTCCCAACAACCCCAATCTCATCACGCCTCAGAGTAGGAATATCCAGACT
GGCCGATCATTCACCTTCGACGCACCAGCAGTCAGTGTGAGCGTTTTGACATTTACGGCTTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail