Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|017900
Gene name
Locationscaffold_10:796544..798030
Strand+
Gene length (bp)1486
Transcript length (bp)1119
Coding sequence length (bp)1119
Protein length (aa) 373

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 572.28 274.63 869.94
Initials Initials knots 361.05 202.26 519.85
Pileal_Stipeal_center Stage I stipe center 844.19 414.48 1273.90
Pileal_Stipeal_shell Stage I stipe shell 685.59 349.24 1021.95
DIF_stipe_center Stage II stipe center 966.34 458.53 1474.15
DIF_stipe_shell Stage II stipe shell 1085.00 499.05 1670.94
DIF_stipe_skin Stage II stipe skin 941.16 449.71 1432.60
DIF_cap_skin Stage II cap skin 1027.44 478.89 1575.99
DIF_cap_tissue Stage II cap tissue 1076.90 485.17 1668.64
DIF_gill_tissue Stage II gill tissue 796.53 394.19 1198.86
YFB_stipe_center Young fruiting body stipe center 1318.68 561.58 2075.79
YFB_stipe_shell Young fruiting body stipe shell 1185.01 532.59 1837.43
YFB_stipe_skin Young fruiting body stipe skin 1015.65 475.19 1556.11
YFB_cap_skin Young fruiting body cap skin 1345.63 578.87 2112.39
YFB_cap_tissue Young fruiting body cap tissue 2046.25 725.95 3366.56
YFB_gill_tissue Young fruiting body gill tissue 886.34 421.26 1351.41
YFB_veil Young fruiting body veil 939.60 445.94 1433.26

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.456197 no
Casing YFB_stipe_center 0.017783 yes
Casing YFB_stipe_shell 0.043983 yes
Casing YFB_stipe_skin 0.118854 no
Casing YFB_cap_skin 0.016386 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.276237 no
Casing YFB_veil 0.202200 no
Casing Initials 0.203521 no
Casing Pileal_Stipeal_center 0.350240 no
Casing Pileal_Stipeal_shell 0.733529 no
Casing DIF_stipe_center 0.167625 no
Casing DIF_stipe_shell 0.087927 no
Casing DIF_stipe_skin 0.201511 no
Casing DIF_cap_skin 0.107767 no
Casing DIF_cap_tissue 0.085045 no
DIF_gill_tissue YFB_stipe_center 0.192285 no
DIF_gill_tissue YFB_stipe_shell 0.333527 no
DIF_gill_tissue YFB_stipe_skin 0.614276 no
DIF_gill_tissue YFB_cap_skin 0.181690 no
DIF_gill_tissue YFB_cap_tissue 0.015242 yes
DIF_gill_tissue YFB_gill_tissue 0.861007 no
DIF_gill_tissue YFB_veil 0.764468 no
YFB_stipe_center YFB_stipe_shell 0.868800 no
YFB_stipe_center YFB_stipe_skin 0.594495 no
YFB_stipe_center YFB_cap_skin 0.979289 no
YFB_stipe_center YFB_cap_tissue 0.367324 no
YFB_stipe_center YFB_gill_tissue 0.352859 no
YFB_stipe_center YFB_veil 0.459266 no
YFB_stipe_shell YFB_stipe_skin 0.788023 no
YFB_stipe_shell YFB_cap_skin 0.847394 no
YFB_stipe_shell YFB_cap_tissue 0.218316 no
YFB_stipe_shell YFB_gill_tissue 0.536250 no
YFB_stipe_shell YFB_veil 0.651813 no
YFB_stipe_skin YFB_cap_skin 0.568000 no
YFB_stipe_skin YFB_cap_tissue 0.087755 no
YFB_stipe_skin YFB_gill_tissue 0.816081 no
YFB_stipe_skin YFB_veil 0.906383 no
YFB_cap_skin YFB_cap_tissue 0.401250 no
YFB_cap_skin YFB_gill_tissue 0.325159 no
YFB_cap_skin YFB_veil 0.428232 no
YFB_cap_tissue YFB_gill_tissue 0.035309 yes
YFB_cap_tissue YFB_veil 0.051723 no
YFB_gill_tissue YFB_veil 0.932928 no
Initials DIF_gill_tissue 0.012274 yes
Initials YFB_stipe_center 0.000613 yes
Initials YFB_stipe_shell 0.000613 yes
Initials YFB_stipe_skin 0.001140 yes
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.002525 yes
Initials YFB_veil 0.002084 yes
Initials Pileal_Stipeal_center 0.008791 yes
Initials Pileal_Stipeal_shell 0.037593 yes
Initials DIF_stipe_center 0.001625 yes
Initials DIF_stipe_shell 0.000613 yes
Initials DIF_stipe_skin 0.001140 yes
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.001140 yes
Pileal_Stipeal_center DIF_gill_tissue 0.930669 no
Pileal_Stipeal_center YFB_stipe_center 0.266138 no
Pileal_Stipeal_center YFB_stipe_shell 0.434709 no
Pileal_Stipeal_center YFB_stipe_skin 0.723016 no
Pileal_Stipeal_center YFB_cap_skin 0.252194 no
Pileal_Stipeal_center YFB_cap_tissue 0.025711 yes
Pileal_Stipeal_center YFB_gill_tissue 0.943502 no
Pileal_Stipeal_center YFB_veil 0.863102 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.669737 no
Pileal_Stipeal_center DIF_stipe_center 0.819195 no
Pileal_Stipeal_center DIF_stipe_shell 0.611662 no
Pileal_Stipeal_center DIF_stipe_skin 0.861706 no
Pileal_Stipeal_center DIF_cap_skin 0.702222 no
Pileal_Stipeal_center DIF_cap_tissue 0.622566 no
Pileal_Stipeal_shell DIF_gill_tissue 0.785110 no
Pileal_Stipeal_shell YFB_stipe_center 0.066022 no
Pileal_Stipeal_shell YFB_stipe_shell 0.133428 no
Pileal_Stipeal_shell YFB_stipe_skin 0.316421 no
Pileal_Stipeal_shell YFB_cap_skin 0.065649 no
Pileal_Stipeal_shell YFB_cap_tissue 0.005302 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.576815 no
Pileal_Stipeal_shell YFB_veil 0.464847 no
Pileal_Stipeal_shell DIF_stipe_center 0.413645 no
Pileal_Stipeal_shell DIF_stipe_shell 0.239533 no
Pileal_Stipeal_shell DIF_stipe_skin 0.465177 no
Pileal_Stipeal_shell DIF_cap_skin 0.304013 no
Pileal_Stipeal_shell DIF_cap_tissue 0.248439 no
DIF_stipe_center DIF_gill_tissue 0.714955 no
DIF_stipe_center YFB_stipe_center 0.512033 no
DIF_stipe_center YFB_stipe_shell 0.697264 no
DIF_stipe_center YFB_stipe_skin 0.941985 no
DIF_stipe_center YFB_cap_skin 0.483886 no
DIF_stipe_center YFB_cap_tissue 0.062807 no
DIF_stipe_center YFB_gill_tissue 0.893034 no
DIF_stipe_center YFB_veil 0.968507 no
DIF_stipe_center DIF_stipe_shell 0.855109 no
DIF_stipe_center DIF_stipe_skin 0.970626 no
DIF_stipe_center DIF_cap_skin 0.926864 no
DIF_stipe_center DIF_cap_tissue 0.866152 no
DIF_stipe_shell DIF_gill_tissue 0.507546 no
DIF_stipe_shell YFB_stipe_center 0.732410 no
DIF_stipe_shell YFB_stipe_shell 0.898925 no
DIF_stipe_shell YFB_stipe_skin 0.924604 no
DIF_stipe_shell YFB_cap_skin 0.704100 no
DIF_stipe_shell YFB_cap_tissue 0.142370 no
DIF_stipe_shell YFB_gill_tissue 0.708192 no
DIF_stipe_shell YFB_veil 0.812859 no
DIF_stipe_shell DIF_stipe_skin 0.818139 no
DIF_stipe_shell DIF_cap_skin 0.938557 no
DIF_stipe_shell DIF_cap_tissue 0.991610 no
DIF_stipe_skin DIF_gill_tissue 0.767201 no
DIF_stipe_skin YFB_stipe_center 0.460991 no
DIF_stipe_skin YFB_stipe_shell 0.650805 no
DIF_stipe_skin YFB_stipe_skin 0.908651 no
DIF_stipe_skin YFB_cap_skin 0.433061 no
DIF_stipe_skin YFB_cap_tissue 0.050294 no
DIF_stipe_skin YFB_gill_tissue 0.931053 no
DIF_stipe_skin YFB_veil 0.997655 no
DIF_stipe_skin DIF_cap_skin 0.892176 no
DIF_stipe_skin DIF_cap_tissue 0.827234 no
DIF_cap_skin DIF_gill_tissue 0.599026 no
DIF_cap_skin YFB_stipe_center 0.624262 no
DIF_cap_skin YFB_stipe_shell 0.805507 no
DIF_cap_skin YFB_stipe_skin 0.986192 no
DIF_cap_skin YFB_cap_skin 0.593498 no
DIF_cap_skin YFB_cap_tissue 0.097776 no
DIF_cap_skin YFB_gill_tissue 0.795974 no
DIF_cap_skin YFB_veil 0.889360 no
DIF_cap_skin DIF_cap_tissue 0.947002 no
DIF_cap_tissue DIF_gill_tissue 0.517197 no
DIF_cap_tissue YFB_stipe_center 0.716320 no
DIF_cap_tissue YFB_stipe_shell 0.881271 no
DIF_cap_tissue YFB_stipe_skin 0.930360 no
DIF_cap_tissue YFB_cap_skin 0.687789 no
DIF_cap_tissue YFB_cap_tissue 0.128955 no
DIF_cap_tissue YFB_gill_tissue 0.720461 no
DIF_cap_tissue YFB_veil 0.819534 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|017900
MPAKFVLASLLLASLSSVVSAASSCIASDIHWNLLAFGFNGKDYDAGTQDSWTQGNATDITTTQGRPPFDGSNVT
CYLSQFTNAIYFMGADASKPNDIHIYDATAKSWSTQAVQQNSFDPTSSGAILDHDTNVFYAYSGGDIYSLDMELL
KAANSTPKAWNDVQKVDWDTSSYQPTVALGQNHIFFLGVPGVNPGSTRIFVIHFSYLQPEPQAFGDIPNMHGKTA
SIFKDEGVQTQFIYVPDDGSATYLLDVTSNTTQTLKAPMNKDAQATYFATTTAVIQLSSSGSVSYLPIDATNEGA
NSNSNWATVSNLPVATPAKPSSASGSASGTGSAGAQSTGSTSDGTMDNGAAVLNVGRWVWSAVALMVGAALF*
Coding >AgabiH97|017900
ATGCCTGCAAAATTCGTCCTTGCTTCCCTCCTTCTTGCCTCGCTCTCTTCTGTAGTATCGGCCGCCTCCTCCTGC
ATCGCATCCGACATCCACTGGAACCTTCTCGCCTTCGGTTTCAATGGCAAGGACTATGACGCTGGCACCCAGGAT
TCCTGGACTCAAGGGAATGCCACGGATATAACAACAACTCAAGGCCGACCCCCTTTCGATGGCTCAAACGTCACC
TGCTATCTGTCACAATTCACAAATGCAATTTATTTCATGGGGGCCGACGCTTCTAAACCTAACGACATCCACATC
TATGATGCCACTGCGAAATCTTGGTCCACCCAAGCTGTACAGCAGAACTCTTTTGATCCAACTAGTTCTGGCGCT
ATCCTTGACCATGACACCAACGTATTCTACGCGTATTCCGGGGGAGACATCTATTCTCTTGATATGGAGCTCCTC
AAGGCAGCTAACAGTACCCCAAAGGCGTGGAATGACGTCCAGAAAGTCGATTGGGATACCTCCAGTTATCAACCC
ACTGTGGCATTGGGCCAGAACCACATCTTTTTCCTAGGAGTTCCGGGAGTAAACCCTGGAAGTACCAGAATTTTT
GTTATCCACTTCTCATACTTGCAGCCCGAACCCCAAGCTTTCGGAGACATCCCAAACATGCATGGTAAAACTGCT
TCTATTTTCAAAGACGAAGGTGTTCAAACCCAATTCATCTATGTCCCTGATGATGGCTCAGCTACTTATCTGCTT
GACGTCACGAGCAACACCACACAGACATTGAAAGCTCCCATGAACAAGGATGCCCAGGCGACTTATTTTGCCACA
ACGACTGCTGTCATCCAACTTTCGTCGTCTGGCTCTGTTTCTTATCTTCCAATCGATGCGACCAACGAGGGTGCC
AATTCTAATTCCAACTGGGCGACTGTCAGTAATTTGCCGGTGGCGACTCCAGCCAAGCCGTCTTCTGCTTCTGGT
TCTGCTTCGGGCACCGGAAGTGCCGGAGCTCAAAGTACTGGCTCGACTTCAGATGGTACGATGGACAATGGTGCT
GCAGTTCTGAATGTTGGACGTTGGGTGTGGAGTGCCGTTGCACTCATGGTCGGAGCAGCGCTCTTCTAA
Transcript >AgabiH97|017900
ATGCCTGCAAAATTCGTCCTTGCTTCCCTCCTTCTTGCCTCGCTCTCTTCTGTAGTATCGGCCGCCTCCTCCTGC
ATCGCATCCGACATCCACTGGAACCTTCTCGCCTTCGGTTTCAATGGCAAGGACTATGACGCTGGCACCCAGGAT
TCCTGGACTCAAGGGAATGCCACGGATATAACAACAACTCAAGGCCGACCCCCTTTCGATGGCTCAAACGTCACC
TGCTATCTGTCACAATTCACAAATGCAATTTATTTCATGGGGGCCGACGCTTCTAAACCTAACGACATCCACATC
TATGATGCCACTGCGAAATCTTGGTCCACCCAAGCTGTACAGCAGAACTCTTTTGATCCAACTAGTTCTGGCGCT
ATCCTTGACCATGACACCAACGTATTCTACGCGTATTCCGGGGGAGACATCTATTCTCTTGATATGGAGCTCCTC
AAGGCAGCTAACAGTACCCCAAAGGCGTGGAATGACGTCCAGAAAGTCGATTGGGATACCTCCAGTTATCAACCC
ACTGTGGCATTGGGCCAGAACCACATCTTTTTCCTAGGAGTTCCGGGAGTAAACCCTGGAAGTACCAGAATTTTT
GTTATCCACTTCTCATACTTGCAGCCCGAACCCCAAGCTTTCGGAGACATCCCAAACATGCATGGTAAAACTGCT
TCTATTTTCAAAGACGAAGGTGTTCAAACCCAATTCATCTATGTCCCTGATGATGGCTCAGCTACTTATCTGCTT
GACGTCACGAGCAACACCACACAGACATTGAAAGCTCCCATGAACAAGGATGCCCAGGCGACTTATTTTGCCACA
ACGACTGCTGTCATCCAACTTTCGTCGTCTGGCTCTGTTTCTTATCTTCCAATCGATGCGACCAACGAGGGTGCC
AATTCTAATTCCAACTGGGCGACTGTCAGTAATTTGCCGGTGGCGACTCCAGCCAAGCCGTCTTCTGCTTCTGGT
TCTGCTTCGGGCACCGGAAGTGCCGGAGCTCAAAGTACTGGCTCGACTTCAGATGGTACGATGGACAATGGTGCT
GCAGTTCTGAATGTTGGACGTTGGGTGTGGAGTGCCGTTGCACTCATGGTCGGAGCAGCGCTCTTCTAA
Gene >AgabiH97|017900
ATGCCTGCAAAATTCGTCCTTGCTTCCCTCCTTCTTGCCTCGCTCTCTTCTGTAGTATCGGCCGCCTCCTCCTGC
ATCGCATCCGACATCCACTGGAACCTTCTCGCCTTCGGTTTCAATGGCAAGGACTATGACGCTGGCACCCAGGAT
TCCTGGACTCAAGGTAAGCAATATATGTTCTCTCATATCTCTTTTTCCATGTGTTAAAAATTTTCTCAGGGAATG
CCACGGATATAACAACAACTCAAGGCCGACCGTAAGTCACCACCAAATATCTGTCCATCCCACCAACGTCAAACC
CATTTTAGCCCTTTCGATGGCTCAAACGTCACCTGCTATCTGTCACAAGTCAGCCCACCTATATTTTCATAATCC
GAATGCTGACATTAGCACCGGCAGTTCACAAATGCAATTTATTTCATGGGGGCCGACGCTTCTAAACCTAACGAC
ATCCACATCTATGATGCCACTGCGAAATCTTGGTCCACCCAAGCTGTACAGCAGAACTCTTTTGATCCAACTAGT
TCTGGCGCTATCCTTGACCATGACACCAACGTATTCTGTACGTAGTCTTTTCTCAATTTTATGAACTTGCTTAAT
TCGAAATTCAGACGCGTATTCCGGGGGAGACATCTATTCTCTTGATATGGAGCTCCTCAAGGCAGCTAACAGTAC
CCCAAAGGCGTGGAATGACGTCCAGAAAGTCGATTGGGATACCTCCAGTTATCAACCCACTGTGGCATTGGGCCA
GAACCACATCTTTTTCCTAGGAGTTCCGGGAGTAAACCCTGGAAGTACCAGAATTTTTGTTATCCACTGTGTGTT
TCTTTGGTTAGGTGACTGTGACCTTCGATAATCTGATTGTTCTCCTAGTCTCATACTTGCAGCCCGAACCCCAAG
CTTTCGGAGACATCCCAAACATGCATGGTAAAACTGCTTCTATTTTCAAAGACGAAGGTGTCAGTGGCAAACTAG
TTATTTCACTCACGTAGTTTCTGATCGATTACCAGGTTCAAACCCAATTCATCTATGTCCCTGATGATGGCTCAG
CTACTTATCTGCTTGACGTCACGGTATGATGGTTCCACCCCGCACTGGCAAAGTGAATTAATCACCGCCTCCGCA
GAGCAACACCACACAGACATTGAAAGCTCCCATGAACAAGGATGCCCAGGCGACTTATTTTGCCACAACGACTGC
TGTCATCCAACTTTCGTCGTCTGGCTCTGTTTCTTATCTTCCAATCGATGCGACCAACGAGGGTGCCAATTCTAA
TTCCAACTGGGCGACTGTCAGTAATTTGCCGGTGGCGACTCCAGCCAAGCCGTCTTCTGCTTCTGGTTCTGCTTC
GGGCACCGGAAGTGCCGGAGCTCAAAGTACTGGCTCGACTTCAGATGGTACGATGGACAATGGTGCTGCAGTTCT
GAATGTTGGACGTTGGGTGTGGAGTGCCGTTGCACTCATGGTCGGAGCAGCGCTCTTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail