Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|017880
Gene name
Locationscaffold_10:791076..794184
Strand+
Gene length (bp)3108
Transcript length (bp)2094
Coding sequence length (bp)2094
Protein length (aa) 698

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11915 DUF3433 Protein of unknown function (DUF3433) 3.0E-19 157 246

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 112 134 22
2 154 176 22
3 223 245 22
4 554 576 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|017880
MGQGSLGCEKEFIPPLNRSVDGKREPIQEFDSSIGNMSYLPPPDIVYTVPDNNGLANTHYKNGSGDKLDAPTQAL
LDTPNHEQFAAYIIDDKRDINGEEEAEPKWLPLPLRVYFWVPFVIALALGAIGLEVALHFSHTRQGWPTSGDIVD
TDNALHYAYTLPPVIVAAILVALWSWTEVEIKKMQPYVDLVHGDSPPHRSLLLDYTRHNNFFVWLRAAANKHYLV
ALASLMALLALAFQPLSAALLSVRDIWFPLDGIPSTNRFLLGLNQNLQFSDLTSFLTGAGYAGAAVLYNLGNPPF
IKDGYTLGPFDLPTSLTTNGTAVANTTAVKSISNCQPVTVNLAQTQTGWTNSINTENCTVTFFVDHNATSLFGTT
LPSCNPQPPAQFSPVIFWFFTYETKPPQASATFCQPTLELWDVTASVDIATGNVTDITPLQPFTSASNFSSLAAN
ITGDPLDGRLYNGIQFDLENPDVFVQRRLEALQLQLPAAMYQAAVQSEPGLVGSFDEDRFVSIANHVYTTYLASV
ARTVYFLRQDEPFTLQVRTFSKRVLLSDTAVHLLAVAMLLLALIGTLIQLLHRYDRRQLRLKHEPGTIASAVSIG
AQTGMGELLAGRQREEDMTHILRGKRFRIDPKSMKIIMEGEDGYEIAASPALRRKSIFAALQATRPWSQRYSTQS
PGLPMSPRSPRTPNAVNVSQGV*
Coding >AgabiH97|017880
ATGGGTCAAGGCTCGTTGGGCTGTGAGAAAGAGTTCATACCCCCCCTTAATAGGAGTGTCGACGGAAAGCGTGAG
CCGATTCAAGAATTTGATTCGTCGATTGGCAACATGTCGTATTTGCCTCCCCCAGACATCGTGTATACTGTGCCG
GACAATAACGGGCTTGCTAACACCCACTACAAGAATGGGTCAGGGGACAAACTTGACGCTCCTACTCAGGCACTT
TTGGACACTCCGAATCATGAACAGTTTGCGGCGTATATAATAGATGATAAACGTGATATTAATGGTGAAGAAGAA
GCTGAACCAAAGTGGCTTCCATTGCCTTTACGAGTGTATTTCTGGGTTCCGTTTGTGATCGCTTTGGCTCTGGGC
GCTATTGGGCTTGAGGTCGCACTTCATTTTAGTCATACGAGGCAAGGGTGGCCGACGAGTGGAGATATTGTGGAC
ACAGATAATGCGTTGCATTACGCTTATACTTTGCCTCCCGTGATTGTAGCAGCGATATTAGTTGCACTTTGGTCA
TGGACAGAAGTCGAGATAAAAAAGATGCAGCCCTACGTTGATCTCGTCCATGGCGATTCACCTCCCCATCGCAGT
TTACTTTTGGATTATACCCGCCACAACAATTTCTTCGTCTGGCTTCGTGCAGCAGCGAATAAACACTACCTTGTC
GCCTTGGCTTCGTTGATGGCATTACTGGCATTGGCTTTCCAACCTCTTTCTGCGGCCCTCTTGTCCGTCAGGGAT
ATCTGGTTCCCTTTAGATGGTATCCCTAGCACCAACCGTTTCCTGCTTGGGTTGAACCAGAACCTTCAGTTCAGT
GATTTGACTTCTTTCCTGACTGGGGCTGGTTACGCTGGTGCAGCGGTCCTTTATAATCTTGGAAATCCTCCTTTT
ATAAAAGATGGATACACACTTGGCCCCTTTGATCTACCCACGTCGCTCACGACCAATGGAACTGCCGTCGCGAAT
ACGACTGCGGTTAAGAGTATTTCAAATTGTCAACCAGTGACGGTGAACTTGGCGCAGACGCAAACAGGTTGGACA
AACTCGATTAACACTGAAAATTGTACCGTTACATTTTTCGTAGATCACAACGCAACTAGCCTTTTCGGGACGACT
CTGCCATCTTGTAATCCACAACCCCCAGCGCAATTCAGTCCTGTCATCTTCTGGTTCTTTACGTATGAAACAAAG
CCTCCTCAAGCGTCTGCAACTTTCTGCCAACCTACCCTTGAATTATGGGATGTGACCGCTAGCGTCGATATTGCG
ACAGGAAATGTGACCGATATAACACCACTGCAGCCCTTCACTTCGGCTTCCAACTTTTCCTCTCTGGCTGCCAAT
ATTACAGGCGATCCCCTTGATGGTCGACTCTATAACGGTATTCAGTTCGACTTGGAGAACCCGGATGTATTTGTC
CAACGTCGGTTGGAGGCGCTTCAACTCCAACTTCCTGCTGCTATGTATCAGGCTGCTGTCCAGAGCGAACCGGGA
CTCGTGGGCAGTTTTGATGAAGACAGATTCGTGTCAATTGCAAATCATGTCTATACGACTTATTTGGCGTCGGTT
GCAAGGACCGTGTATTTCTTACGTCAGGATGAGCCTTTCACTCTCCAGGTTAGGACGTTTAGTAAACGTGTCTTG
TTGAGTGATACGGCGGTCCATCTTTTGGCGGTAGCGATGCTGCTCTTGGCTCTAATCGGGACTCTCATCCAGTTA
TTACACCGCTATGATCGTCGGCAATTGCGCTTAAAGCACGAACCTGGAACTATCGCCTCCGCTGTATCCATTGGA
GCACAGACGGGAATGGGAGAGCTTCTTGCAGGTCGGCAGAGGGAAGAAGACATGACTCACATTCTCCGCGGTAAA
AGATTCAGAATCGACCCGAAATCTATGAAGATTATTATGGAGGGAGAGGATGGGTATGAAATCGCCGCTAGCCCA
GCCCTGAGGCGCAAGTCAATATTTGCAGCGCTACAAGCTACGAGACCATGGAGTCAACGTTACTCAACTCAGTCG
CCTGGATTACCCATGTCGCCGAGATCACCGAGGACACCGAATGCTGTGAATGTTAGCCAAGGAGTCTGA
Transcript >AgabiH97|017880
ATGGGTCAAGGCTCGTTGGGCTGTGAGAAAGAGTTCATACCCCCCCTTAATAGGAGTGTCGACGGAAAGCGTGAG
CCGATTCAAGAATTTGATTCGTCGATTGGCAACATGTCGTATTTGCCTCCCCCAGACATCGTGTATACTGTGCCG
GACAATAACGGGCTTGCTAACACCCACTACAAGAATGGGTCAGGGGACAAACTTGACGCTCCTACTCAGGCACTT
TTGGACACTCCGAATCATGAACAGTTTGCGGCGTATATAATAGATGATAAACGTGATATTAATGGTGAAGAAGAA
GCTGAACCAAAGTGGCTTCCATTGCCTTTACGAGTGTATTTCTGGGTTCCGTTTGTGATCGCTTTGGCTCTGGGC
GCTATTGGGCTTGAGGTCGCACTTCATTTTAGTCATACGAGGCAAGGGTGGCCGACGAGTGGAGATATTGTGGAC
ACAGATAATGCGTTGCATTACGCTTATACTTTGCCTCCCGTGATTGTAGCAGCGATATTAGTTGCACTTTGGTCA
TGGACAGAAGTCGAGATAAAAAAGATGCAGCCCTACGTTGATCTCGTCCATGGCGATTCACCTCCCCATCGCAGT
TTACTTTTGGATTATACCCGCCACAACAATTTCTTCGTCTGGCTTCGTGCAGCAGCGAATAAACACTACCTTGTC
GCCTTGGCTTCGTTGATGGCATTACTGGCATTGGCTTTCCAACCTCTTTCTGCGGCCCTCTTGTCCGTCAGGGAT
ATCTGGTTCCCTTTAGATGGTATCCCTAGCACCAACCGTTTCCTGCTTGGGTTGAACCAGAACCTTCAGTTCAGT
GATTTGACTTCTTTCCTGACTGGGGCTGGTTACGCTGGTGCAGCGGTCCTTTATAATCTTGGAAATCCTCCTTTT
ATAAAAGATGGATACACACTTGGCCCCTTTGATCTACCCACGTCGCTCACGACCAATGGAACTGCCGTCGCGAAT
ACGACTGCGGTTAAGAGTATTTCAAATTGTCAACCAGTGACGGTGAACTTGGCGCAGACGCAAACAGGTTGGACA
AACTCGATTAACACTGAAAATTGTACCGTTACATTTTTCGTAGATCACAACGCAACTAGCCTTTTCGGGACGACT
CTGCCATCTTGTAATCCACAACCCCCAGCGCAATTCAGTCCTGTCATCTTCTGGTTCTTTACGTATGAAACAAAG
CCTCCTCAAGCGTCTGCAACTTTCTGCCAACCTACCCTTGAATTATGGGATGTGACCGCTAGCGTCGATATTGCG
ACAGGAAATGTGACCGATATAACACCACTGCAGCCCTTCACTTCGGCTTCCAACTTTTCCTCTCTGGCTGCCAAT
ATTACAGGCGATCCCCTTGATGGTCGACTCTATAACGGTATTCAGTTCGACTTGGAGAACCCGGATGTATTTGTC
CAACGTCGGTTGGAGGCGCTTCAACTCCAACTTCCTGCTGCTATGTATCAGGCTGCTGTCCAGAGCGAACCGGGA
CTCGTGGGCAGTTTTGATGAAGACAGATTCGTGTCAATTGCAAATCATGTCTATACGACTTATTTGGCGTCGGTT
GCAAGGACCGTGTATTTCTTACGTCAGGATGAGCCTTTCACTCTCCAGGTTAGGACGTTTAGTAAACGTGTCTTG
TTGAGTGATACGGCGGTCCATCTTTTGGCGGTAGCGATGCTGCTCTTGGCTCTAATCGGGACTCTCATCCAGTTA
TTACACCGCTATGATCGTCGGCAATTGCGCTTAAAGCACGAACCTGGAACTATCGCCTCCGCTGTATCCATTGGA
GCACAGACGGGAATGGGAGAGCTTCTTGCAGGTCGGCAGAGGGAAGAAGACATGACTCACATTCTCCGCGGTAAA
AGATTCAGAATCGACCCGAAATCTATGAAGATTATTATGGAGGGAGAGGATGGGTATGAAATCGCCGCTAGCCCA
GCCCTGAGGCGCAAGTCAATATTTGCAGCGCTACAAGCTACGAGACCATGGAGTCAACGTTACTCAACTCAGTCG
CCTGGATTACCCATGTCGCCGAGATCACCGAGGACACCGAATGCTGTGAATGTTAGCCAAGGAGTCTGA
Gene >AgabiH97|017880
ATGGGTCAAGGTGATCGTTCTACCGCATCAAATTCAGAACCAACATAAATTTGGCCAGGCTCGTTGGGCTGTGAG
AAAGAGTTCATACCCCCCCTGTATTCCTTTTCCTTCTTTTCCTTTGACTTCCTCCTTCCCTTGATCTTTATATTT
TCTTTGTTTTTTTTTTCTCAGCTGTCGGAGCTAGTCGCTGTGGTCTTATTCGAGGCCTATGGCAACTATGAGCAG
TAATAGGAGTGTCGACGGAAAGCGTGAGCCGATTCAAGAATTTGATTCGTCGATTGGCAACATGTCGTATTTGCC
TCCCCCAGACATCGTGTATACTGTGGTATGTTCTCTCATACAACATAGTTAATTTTTTTTCTAACCTTGCTAGCC
GGACAATAACGGGCTTGCTAACACCCACTACAAGAATGGGTCAGGGGACAAACTTGACGCTCCTACTCAGGCACT
TTTGGACACTCCGAATCATGAACAGTTTGCGGCGTATATAATAGATGATAAACGTGCGCGGGATATCTTATTTGA
ACATATATTTTTGGCTTGATTATTGACGATTTTTTTCCAGGTGATATTAATGGTGAAGAAGAAGCTGAACCAAAG
TGGCTTCCATTGCCTTTACGAGTGTATTTCTGGGTTCCGTTTGTGATCGCTTTGGCTCTGGGCGCTATTGGGCTT
GAGGTCGCACTTCATTTTAGTCATACGAGGCAAGGTGCGTTTTTGAGAATTGTGTTCGCTTTTTTTTTTTGGTTT
GGCTGAAGCCCTTACTCTAGGGTGGCCGACGAGTGGAGATATTGTGGACACAGATAATGCGTTGCATTACGCTTA
TGTGAGTTTTGTGTTGAACATTTGGCTTACGGATGGCGTGACTGATACGTTCTGTAGACTTTGCCTCCCGTGATT
GTAGCAGCGATAGTGAGTGCAAATCCTAGTTCTGAATGATTGAACGCGTCTTCATAATTTTTTTTCAGTTAGTTG
CACTTTGGTCATGGACAGAAGTCGAGATAAAAAAGATGCAGGTAATGTCCATCGACTGCGCCAAGTCGGCTGTTG
GTTGTTGACTTGGATATTCTTAGCCCTACGTTGATCTCGTCCATGGCGATTCACCTCCCCATCGCAGTTTACTTT
TGGATTATACCCGCCACAAGTGAGAGCTTATACCAGTCTGATGCTGTGTGCATGATTTACTGGTGAGAATGTTCC
AGCAATTTCTTCGTCTGGCTTCGTGCAGCAGCGAATAAACACTACCTTGTCGCCTTGGCTTCGTTGATGGCATTA
CTGGCATTGGCTTTCCAACCTCTTTCTGCGGCCCTCTTGTCCGTCAGGGATATCTGGTTCCCTTTAGATGGTGTG
TAGCCGGAATGGTCATTTTTCGTTAGCATGAACTAAGCCATCAATTAGGTATCCCTAGCACCAACCGTTTCCTGC
TTGGGTTGAACCAGAACCTTCAGTTCAGTGATTTGACTTGTGCGTATTCCCTCTGTGGTCGTACTATGTTGCAGG
TAGCTGACTTGTAATCCTAGCTTTCCTGACTGGGGCTGGTTACGCTGGTGCAGCGGTCCTTTATAATCTTGGAAA
TCCTCCTTTTATAAAAGATGGATACACACTTGGCCCCTTTGATGTCAGTGGATTTTTCTCGACACTTGAACATCC
GTTTCTGACAGTTTGGCTTGACAGCTACCCACGTCGCTCACGACCAATGGAACTGCCGTCGCGAATACGACTGCG
GTTAAGAGTATTTCAAATTGTCAACCAGTGACGGTGAGCTATTTTGATTGGTTTCTTAGTCTAACCCGTCTGATG
ATTCCTGCTAGGTGAACTTGGCGCAGACGCAAACAGGTTGGACAAACTCGATTAACACTGAAAATTGTACCGTTA
CATTTTTCGTAGATCACAACGCAACTAGCCTTTTCGGTGTGCATCATACCCTATATGTTCTCGCTTAATTGGATT
TTAACTGCATGCCATAGGGACGACTCTGCCATCTTGTAATCCACAACCCCCAGCGCAATTCAGTCCTGTCATCTT
CTGGTTCTTTACGTGAGTTGGCCAATGTAGTAACCTCCTGACCAACTTTCGCTTATTCGGGGTTGCCTTAGGTAT
GAAACAAAGCCTCCTCAAGCGTCTGCAACTTTCTGCCAACCTACCCTTGAATTATGGGATGTGACCGCTAGCGTC
GATATTGCGACAGGAAATGTGACCGATATAACACCACTGCAGCCCTTCACTTCGGCTTCCAACTTTTCCTCTCTG
GCTGCCAATATTACAGGCGATCCCCTTGATGGTCGACTCTATAACGGTATTCAGTTCGACTTGGAGAACCCGGAT
GTATTTGTCCAACGTCGGTTGGAGGCGCTTCAACTCCAACTTCCTGCTGCTATGTATCAGGCTGCTGTCCAGAGC
GAACCGGGACTCGTGGGCAGTTTTGATGAAGACAGATTCGTGTCAATTGCAAATCATGTCTATGTAAGCCTTTTC
GGCGATGCTTTATTCAAACATGCTAAATACATCATAGACGACTTATTTGGCGTCGGTTGCAAGGACCGTGTATTT
CTTACGTCAGGATGAGCCTTTCACTCTCCAGGTTAGGACGTTTAGTAAACGTGTCTTGTTGAGGTATGTCCAGAC
CCGTTGGAATGCTTCAGGCAACAATTTTCTCATCTCTGTGGCAGTGATACGGCGGTCCATCTTTTGGCGGTAGCG
ATGCTGCTCTTGGCTCTAATCGGGACTCTCATCCAGTTATTACACCGCTATGATCGTCGGCAATTGCGCTTAAAG
CACGAACCTGGAACTATCGCCTCCGCTGTATCCATTGGAGCACAGACGGGAATGGGAGAGCTTCTTGCAGGTCGG
CAGAGGGAAGAAGACATGACTCACATTCTCCGCGGTAAAAGATTCAGAATCGACCCGAAATCTATGAAGATTATT
ATGGAGGGAGAGGATGGGTATGAAATCGCCGCTAGCCCAGCCCTGAGGCGCAAGTCAATATTTGCAGCGCTACAA
GCTACGAGACCATGGAGTCAACGTTACTCAACTCAGTCGCCTGGATTACCCATGTCGCCGAGATCACCGAGGACA
CCGAATGCTGTGAATGTTAGCCAAGGAGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail