Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|017750
Gene name
Locationscaffold_10:754045..757466
Strand-
Gene length (bp)3421
Transcript length (bp)3036
Coding sequence length (bp)3036
Protein length (aa) 1012

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q80T14|FRAS1_MOUSE Extracellular matrix protein FRAS1 OS=Mus musculus GN=Fras1 PE=1 SV=2 365 571 5.0E-19
sp|Q86XX4|FRAS1_HUMAN Extracellular matrix protein FRAS1 OS=Homo sapiens GN=FRAS1 PE=1 SV=2 342 574 5.0E-19
sp|Q86XX4|FRAS1_HUMAN Extracellular matrix protein FRAS1 OS=Homo sapiens GN=FRAS1 PE=1 SV=2 352 569 4.0E-18
sp|Q80T14|FRAS1_MOUSE Extracellular matrix protein FRAS1 OS=Mus musculus GN=Fras1 PE=1 SV=2 351 563 9.0E-18
sp|P29122|PCSK6_HUMAN Proprotein convertase subtilisin/kexin type 6 OS=Homo sapiens GN=PCSK6 PE=1 SV=1 400 556 5.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q80T14|FRAS1_MOUSE Extracellular matrix protein FRAS1 OS=Mus musculus GN=Fras1 PE=1 SV=2 365 571 5.0E-19
sp|Q86XX4|FRAS1_HUMAN Extracellular matrix protein FRAS1 OS=Homo sapiens GN=FRAS1 PE=1 SV=2 342 574 5.0E-19
sp|Q86XX4|FRAS1_HUMAN Extracellular matrix protein FRAS1 OS=Homo sapiens GN=FRAS1 PE=1 SV=2 352 569 4.0E-18
sp|Q80T14|FRAS1_MOUSE Extracellular matrix protein FRAS1 OS=Mus musculus GN=Fras1 PE=1 SV=2 351 563 9.0E-18
sp|P29122|PCSK6_HUMAN Proprotein convertase subtilisin/kexin type 6 OS=Homo sapiens GN=PCSK6 PE=1 SV=1 400 556 5.0E-17
sp|P30432|FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster GN=Fur2 PE=2 SV=2 396 555 3.0E-16
sp|Q86XX4|FRAS1_HUMAN Extracellular matrix protein FRAS1 OS=Homo sapiens GN=FRAS1 PE=1 SV=2 401 569 4.0E-16
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 378 574 1.0E-14
sp|Q63415|PCSK6_RAT Proprotein convertase subtilisin/kexin type 6 OS=Rattus norvegicus GN=Pcsk6 PE=2 SV=1 400 558 2.0E-14
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 376 574 4.0E-14
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 351 555 4.0E-14
sp|Q86XX4|FRAS1_HUMAN Extracellular matrix protein FRAS1 OS=Homo sapiens GN=FRAS1 PE=1 SV=2 401 568 6.0E-14
sp|Q80T14|FRAS1_MOUSE Extracellular matrix protein FRAS1 OS=Mus musculus GN=Fras1 PE=1 SV=2 409 569 6.0E-14
sp|Q86XX4|FRAS1_HUMAN Extracellular matrix protein FRAS1 OS=Homo sapiens GN=FRAS1 PE=1 SV=2 419 571 3.0E-13
sp|P30432|FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster GN=Fur2 PE=2 SV=2 347 570 3.0E-13
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 351 555 3.0E-13
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 401 571 1.0E-12
sp|Q80T14|FRAS1_MOUSE Extracellular matrix protein FRAS1 OS=Mus musculus GN=Fras1 PE=1 SV=2 406 570 2.0E-12
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 409 551 5.0E-12
sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiense GN=PC6 PE=2 SV=1 409 555 8.0E-12
sp|Q86XX4|FRAS1_HUMAN Extracellular matrix protein FRAS1 OS=Homo sapiens GN=FRAS1 PE=1 SV=2 377 555 9.0E-12
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 401 571 9.0E-12
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 401 569 1.0E-11
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 400 568 1.0E-11
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 400 555 1.0E-11
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 401 569 1.0E-11
sp|Q80T14|FRAS1_MOUSE Extracellular matrix protein FRAS1 OS=Mus musculus GN=Fras1 PE=1 SV=2 408 579 2.0E-11
sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiense GN=PC6 PE=2 SV=1 396 574 3.0E-11
sp|Q80T14|FRAS1_MOUSE Extracellular matrix protein FRAS1 OS=Mus musculus GN=Fras1 PE=1 SV=2 365 591 3.0E-11
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 400 555 4.0E-11
sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiense GN=PC6 PE=2 SV=1 381 555 5.0E-11
sp|P30432|FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster GN=Fur2 PE=2 SV=2 400 555 5.0E-11
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 400 555 7.0E-11
sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiense GN=PC6 PE=2 SV=1 433 571 2.0E-10
sp|Q80T14|FRAS1_MOUSE Extracellular matrix protein FRAS1 OS=Mus musculus GN=Fras1 PE=1 SV=2 401 555 2.0E-10
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 409 555 4.0E-10
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 401 575 1.0E-09
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 409 555 2.0E-09
sp|Q8R4U0|STAB2_MOUSE Stabilin-2 OS=Mus musculus GN=Stab2 PE=1 SV=1 202 255 2.0E-09
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 415 571 4.0E-09
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 401 568 8.0E-09
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 378 555 8.0E-09
sp|Q8WWQ8|STAB2_HUMAN Stabilin-2 OS=Homo sapiens GN=STAB2 PE=1 SV=3 202 255 9.0E-09
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 415 571 1.0E-08
sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiense GN=PC6 PE=2 SV=1 378 558 1.0E-08
sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiense GN=PC6 PE=2 SV=1 378 570 1.0E-08
sp|Q86XX4|FRAS1_HUMAN Extracellular matrix protein FRAS1 OS=Homo sapiens GN=FRAS1 PE=1 SV=2 378 589 1.0E-08
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 401 569 2.0E-08
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 401 576 3.0E-08
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 378 555 4.0E-08
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 434 568 4.0E-08
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 434 568 8.0E-08
sp|Q8CFM6|STAB2_RAT Stabilin-2 (Fragment) OS=Rattus norvegicus GN=Stab2 PE=1 SV=1 207 255 9.0E-08
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 378 555 2.0E-07
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 433 568 2.0E-07
sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiense GN=PC6 PE=2 SV=1 400 571 3.0E-07
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 434 568 3.0E-07
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 346 562 3.0E-07
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 415 571 4.0E-07
sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiense GN=PC6 PE=2 SV=1 401 570 4.0E-07
sp|P04412|EGFR_DROME Epidermal growth factor receptor OS=Drosophila melanogaster GN=Egfr PE=1 SV=3 400 557 9.0E-07
sp|Q9NY15|STAB1_HUMAN Stabilin-1 OS=Homo sapiens GN=STAB1 PE=1 SV=3 202 255 1.0E-06
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 383 546 2.0E-06
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 377 569 2.0E-06
sp|Q80T14|FRAS1_MOUSE Extracellular matrix protein FRAS1 OS=Mus musculus GN=Fras1 PE=1 SV=2 378 569 2.0E-06
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 382 572 3.0E-06
sp|Q8R4Y4|STAB1_MOUSE Stabilin-1 OS=Mus musculus GN=Stab1 PE=1 SV=1 208 255 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 636 658 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|017750
MTLMLFLASLLATVSFSNAASDSTLVCVPQRCLQGDSNITLGAKLSNSASSIPIHLLPGEYTTTTNSELLRDALT
SSTTTLSPSAGFSNASSSLSNSLPLELFLQPGIATFSSRLYSGQTAFTALPDSTNNNNTSSSTPLVAESVALSSN
VVAITTSSSNRLVLWDSIPDTGHLPPPFNNAQLSLVDIQSTTCSPLCSSSGGICNSQGQCVCRDGFTGSSCEECS
SGRFGPDCRVCGEDDCEKCDEGVSGTGRCLKKKRSGNDCNCVNGVCGDDGNLAIVKLVKSDVLNAQTVPVIVSPA
NPVPHKTRTTVLYAYHLPKSQLPELNAHNSPSPTATLVPLAPLLAKHVPVVPPMIVLNVFKDNICSMAFVSKRMG
TVCGAKCTSCKIPDFSIASIVTQLQCTGCVPGSFLSDGKCVDSCPDGTFVSAQDGVTCQKCDSSCSTCSGSSTFC
LSCSSQTQLTFNGACVAADSCPKSTFASDSTTSCISCHPDCSECSDSGFNKCTACPTERPVLVNGRCLSTCSKNE
YWDSNANECKACDSSCGSCTGPGSSSCLSCSNANDRVLRSGSCVSSSNACSSLGNDTSVINPLGVCFAELVVATD
TSNPGKPVDPDEPDDPGLGEQPGTTTTRTEKLKLEWWQILLMALGCAFIFLAFIWCCCRRRRKKRKEEARRRLQG
YAFANVAGSNKRPWWRSCGRRKKNQEINVHYDPAFDHDAAIRRSGWKHRLVRFGEKFFGHSKSTRGYYASRSSIE
METTVNGKSIQVFHDTKHRSLYHSPPPRYRSNSDAISYRDRDVDIERIASPTRRRTSFPTEPFRHSRSSLEHDFS
RRDSHEGNDLHGENTRSQFQREHEHRHREEDGEDTDMIELISQYRNIKTPPATKKNFLHHGSRSRSTLRNPRHHS
NASGAHLLGSPSSRSHENDEVDDYYGQEEYYRRSYSSTISTDSLYSQVTGRTRRTPEARQRVRDEEQEEFPPILK
SKFSMSTLGTGNDISQDRRKLKKKPDQERGSSSFWK*
Coding >AgabiH97|017750
ATGACTCTTATGCTCTTCCTCGCGTCTTTGCTTGCTACTGTGTCTTTTTCAAATGCTGCGTCGGATTCTACTTTG
GTTTGCGTACCACAGCGTTGTTTGCAAGGAGATTCCAATATCACTCTTGGAGCTAAACTCTCGAATTCTGCTTCT
TCTATACCCATCCACCTCTTACCCGGCGAATATACCACGACAACGAACTCAGAATTATTACGCGATGCTTTGACA
TCTTCGACGACGACGCTCTCTCCCTCTGCTGGTTTTTCCAATGCTTCATCATCGCTTTCCAATAGTCTTCCTTTG
GAACTATTTCTTCAGCCTGGAATAGCGACTTTTTCATCGCGTTTGTATTCTGGACAAACTGCATTCACAGCACTA
CCTGATTCCACGAATAATAACAATACATCGTCGTCAACGCCACTGGTTGCTGAATCGGTGGCGCTTTCGAGTAAT
GTGGTTGCGATAACGACTTCGTCGTCTAATCGATTGGTTTTATGGGATTCGATACCTGATACAGGACATCTTCCA
CCACCGTTCAATAATGCTCAACTTTCGCTTGTGGATATTCAATCAACGACATGTTCGCCTTTATGTTCTTCTTCT
GGAGGAATATGTAATTCTCAAGGTCAATGTGTATGTCGAGATGGATTCACTGGTTCTTCTTGTGAGGAATGTTCT
TCTGGACGGTTTGGTCCGGATTGTCGGGTTTGTGGTGAGGATGATTGCGAGAAATGTGATGAAGGCGTTTCTGGG
ACAGGGAGATGTTTGAAGAAGAAGAGGAGTGGGAATGATTGTAATTGTGTGAATGGGGTTTGTGGTGACGATGGG
AATTTGGCGATTGTAAAGCTTGTCAAGTCGGATGTACTAAATGCGCAGACGGTTCCGGTGATTGTCTCTCCTGCC
AATCCGGTTCCACACAAAACCAGAACGACCGTGCTCTATGCATACCATCTACCCAAGTCACAACTACCGGAACTC
AATGCCCACAACTCGCCTTCGCCAACGGCGACACTTGTTCCCCTTGCGCCGCTTCTTGCCAAACATGTTCCGGTG
GTACCTCCAATGATTGTACTGAATGTGTTCAAGGACAATATATGCTCAATGGCGTTTGTGTCAAAGCGAATGGGG
ACGGTCTGTGGTGCGAAATGCACTTCTTGCAAGATTCCGGATTTTAGTATTGCGTCTATTGTTACGCAGCTTCAG
TGCACGGGTTGTGTGCCTGGGAGTTTTCTGTCTGATGGGAAATGTGTCGATTCGTGTCCAGATGGAACTTTCGTT
TCTGCTCAGGATGGTGTGACTTGTCAAAAATGCGATTCAAGTTGTAGCACTTGTTCAGGCTCTTCTACATTTTGC
CTCTCTTGCTCCTCTCAAACACAGCTGACGTTCAACGGTGCATGCGTCGCTGCCGATTCTTGTCCCAAATCCACT
TTCGCATCGGACTCGACAACTTCCTGTATCTCTTGTCATCCCGACTGCTCCGAATGTTCCGATTCCGGTTTCAAC
AAATGTACAGCATGTCCAACTGAGAGACCTGTACTCGTCAACGGACGATGTTTGTCTACGTGTTCCAAGAACGAA
TATTGGGACTCGAACGCGAATGAGTGCAAGGCCTGTGATAGTTCTTGTGGAAGTTGTACTGGGCCAGGATCGTCA
AGTTGCCTTTCGTGTTCAAACGCCAATGATAGAGTTCTTCGTTCTGGTTCTTGCGTTTCTTCCTCAAACGCTTGT
TCGTCTTTGGGTAATGATACATCTGTTATCAACCCTTTAGGCGTATGTTTCGCTGAACTTGTTGTGGCAACCGAC
ACGAGTAATCCTGGTAAACCTGTTGATCCTGATGAGCCTGATGATCCAGGTTTAGGTGAACAACCAGGGACAACG
ACAACGCGCACTGAGAAGTTGAAACTTGAGTGGTGGCAGATATTGTTGATGGCACTGGGATGTGCGTTTATATTC
CTCGCTTTCATCTGGTGTTGTTGTAGGAGGAGGAGAAAGAAGAGAAAGGAAGAGGCAAGGAGACGTCTTCAAGGT
TACGCTTTTGCCAACGTTGCTGGTTCAAACAAGCGACCTTGGTGGAGGAGCTGTGGCAGGAGGAAGAAGAATCAA
GAGATCAACGTCCATTACGATCCAGCTTTTGATCATGATGCTGCGATACGACGTAGTGGATGGAAACATCGTCTT
GTTCGATTTGGTGAAAAGTTCTTTGGACATTCGAAATCTACTCGTGGTTATTATGCTTCTCGCTCTTCCATTGAA
ATGGAAACGACGGTCAATGGGAAGTCAATTCAAGTATTTCATGATACCAAACATCGTTCGCTTTATCACTCACCT
CCTCCTCGTTATCGATCAAATTCGGATGCTATTTCATATCGTGATCGTGATGTCGATATTGAACGTATAGCTTCT
CCTACACGACGACGAACATCCTTCCCTACTGAACCTTTTCGTCATTCCCGTTCAAGTCTGGAACATGACTTTAGC
AGGAGGGATTCGCATGAAGGAAACGATCTACATGGCGAGAATACTCGTAGCCAATTTCAAAGGGAACATGAGCAC
CGACACCGAGAGGAAGACGGCGAAGACACAGATATGATAGAACTTATCTCTCAATATCGAAACATCAAAACACCT
CCCGCGACGAAAAAGAATTTTCTCCACCACGGTTCTCGTTCTCGATCTACTCTGCGCAATCCCCGTCACCACTCT
AATGCTAGTGGAGCACATTTATTGGGATCACCATCGTCACGAAGCCACGAAAACGATGAAGTTGACGATTACTAT
GGTCAAGAGGAATACTATAGACGATCTTACTCAAGCACTATATCCACAGATTCGTTGTATTCCCAAGTGACGGGT
CGTACCAGGCGTACACCCGAGGCTCGGCAACGAGTACGTGATGAAGAACAAGAAGAATTTCCACCGATACTGAAG
AGCAAGTTCTCTATGAGTACCCTCGGTACCGGCAATGATATTTCACAGGATCGAAGAAAGCTCAAGAAAAAACCT
GATCAGGAACGTGGATCATCCTCATTCTGGAAGTGA
Transcript >AgabiH97|017750
ATGACTCTTATGCTCTTCCTCGCGTCTTTGCTTGCTACTGTGTCTTTTTCAAATGCTGCGTCGGATTCTACTTTG
GTTTGCGTACCACAGCGTTGTTTGCAAGGAGATTCCAATATCACTCTTGGAGCTAAACTCTCGAATTCTGCTTCT
TCTATACCCATCCACCTCTTACCCGGCGAATATACCACGACAACGAACTCAGAATTATTACGCGATGCTTTGACA
TCTTCGACGACGACGCTCTCTCCCTCTGCTGGTTTTTCCAATGCTTCATCATCGCTTTCCAATAGTCTTCCTTTG
GAACTATTTCTTCAGCCTGGAATAGCGACTTTTTCATCGCGTTTGTATTCTGGACAAACTGCATTCACAGCACTA
CCTGATTCCACGAATAATAACAATACATCGTCGTCAACGCCACTGGTTGCTGAATCGGTGGCGCTTTCGAGTAAT
GTGGTTGCGATAACGACTTCGTCGTCTAATCGATTGGTTTTATGGGATTCGATACCTGATACAGGACATCTTCCA
CCACCGTTCAATAATGCTCAACTTTCGCTTGTGGATATTCAATCAACGACATGTTCGCCTTTATGTTCTTCTTCT
GGAGGAATATGTAATTCTCAAGGTCAATGTGTATGTCGAGATGGATTCACTGGTTCTTCTTGTGAGGAATGTTCT
TCTGGACGGTTTGGTCCGGATTGTCGGGTTTGTGGTGAGGATGATTGCGAGAAATGTGATGAAGGCGTTTCTGGG
ACAGGGAGATGTTTGAAGAAGAAGAGGAGTGGGAATGATTGTAATTGTGTGAATGGGGTTTGTGGTGACGATGGG
AATTTGGCGATTGTAAAGCTTGTCAAGTCGGATGTACTAAATGCGCAGACGGTTCCGGTGATTGTCTCTCCTGCC
AATCCGGTTCCACACAAAACCAGAACGACCGTGCTCTATGCATACCATCTACCCAAGTCACAACTACCGGAACTC
AATGCCCACAACTCGCCTTCGCCAACGGCGACACTTGTTCCCCTTGCGCCGCTTCTTGCCAAACATGTTCCGGTG
GTACCTCCAATGATTGTACTGAATGTGTTCAAGGACAATATATGCTCAATGGCGTTTGTGTCAAAGCGAATGGGG
ACGGTCTGTGGTGCGAAATGCACTTCTTGCAAGATTCCGGATTTTAGTATTGCGTCTATTGTTACGCAGCTTCAG
TGCACGGGTTGTGTGCCTGGGAGTTTTCTGTCTGATGGGAAATGTGTCGATTCGTGTCCAGATGGAACTTTCGTT
TCTGCTCAGGATGGTGTGACTTGTCAAAAATGCGATTCAAGTTGTAGCACTTGTTCAGGCTCTTCTACATTTTGC
CTCTCTTGCTCCTCTCAAACACAGCTGACGTTCAACGGTGCATGCGTCGCTGCCGATTCTTGTCCCAAATCCACT
TTCGCATCGGACTCGACAACTTCCTGTATCTCTTGTCATCCCGACTGCTCCGAATGTTCCGATTCCGGTTTCAAC
AAATGTACAGCATGTCCAACTGAGAGACCTGTACTCGTCAACGGACGATGTTTGTCTACGTGTTCCAAGAACGAA
TATTGGGACTCGAACGCGAATGAGTGCAAGGCCTGTGATAGTTCTTGTGGAAGTTGTACTGGGCCAGGATCGTCA
AGTTGCCTTTCGTGTTCAAACGCCAATGATAGAGTTCTTCGTTCTGGTTCTTGCGTTTCTTCCTCAAACGCTTGT
TCGTCTTTGGGTAATGATACATCTGTTATCAACCCTTTAGGCGTATGTTTCGCTGAACTTGTTGTGGCAACCGAC
ACGAGTAATCCTGGTAAACCTGTTGATCCTGATGAGCCTGATGATCCAGGTTTAGGTGAACAACCAGGGACAACG
ACAACGCGCACTGAGAAGTTGAAACTTGAGTGGTGGCAGATATTGTTGATGGCACTGGGATGTGCGTTTATATTC
CTCGCTTTCATCTGGTGTTGTTGTAGGAGGAGGAGAAAGAAGAGAAAGGAAGAGGCAAGGAGACGTCTTCAAGGT
TACGCTTTTGCCAACGTTGCTGGTTCAAACAAGCGACCTTGGTGGAGGAGCTGTGGCAGGAGGAAGAAGAATCAA
GAGATCAACGTCCATTACGATCCAGCTTTTGATCATGATGCTGCGATACGACGTAGTGGATGGAAACATCGTCTT
GTTCGATTTGGTGAAAAGTTCTTTGGACATTCGAAATCTACTCGTGGTTATTATGCTTCTCGCTCTTCCATTGAA
ATGGAAACGACGGTCAATGGGAAGTCAATTCAAGTATTTCATGATACCAAACATCGTTCGCTTTATCACTCACCT
CCTCCTCGTTATCGATCAAATTCGGATGCTATTTCATATCGTGATCGTGATGTCGATATTGAACGTATAGCTTCT
CCTACACGACGACGAACATCCTTCCCTACTGAACCTTTTCGTCATTCCCGTTCAAGTCTGGAACATGACTTTAGC
AGGAGGGATTCGCATGAAGGAAACGATCTACATGGCGAGAATACTCGTAGCCAATTTCAAAGGGAACATGAGCAC
CGACACCGAGAGGAAGACGGCGAAGACACAGATATGATAGAACTTATCTCTCAATATCGAAACATCAAAACACCT
CCCGCGACGAAAAAGAATTTTCTCCACCACGGTTCTCGTTCTCGATCTACTCTGCGCAATCCCCGTCACCACTCT
AATGCTAGTGGAGCACATTTATTGGGATCACCATCGTCACGAAGCCACGAAAACGATGAAGTTGACGATTACTAT
GGTCAAGAGGAATACTATAGACGATCTTACTCAAGCACTATATCCACAGATTCGTTGTATTCCCAAGTGACGGGT
CGTACCAGGCGTACACCCGAGGCTCGGCAACGAGTACGTGATGAAGAACAAGAAGAATTTCCACCGATACTGAAG
AGCAAGTTCTCTATGAGTACCCTCGGTACCGGCAATGATATTTCACAGGATCGAAGAAAGCTCAAGAAAAAACCT
GATCAGGAACGTGGATCATCCTCATTCTGGAAGTGA
Gene >AgabiH97|017750
ATGACTCTTATGCTCTTCCTCGCGTCTTTGCTTGCTACTGTGTCTTTTTCAAATGGTTCGTTTGGGGGAATTTTT
TTATTGTTGTACTACGTGTTGTGGGTGCTAATGATCTCTGTGTTCTCTTTAGCTGCGTCGGATTCTACTTTGGTT
TGCGTACCACAGCGTTGTTTGCAAGGAGATTCCAATATCACTCGTATGCTCTTGCAATCTCCTTTCTCAAAGAAC
CTCTCTGACTTTTTTTTCTTTGCTTTCGTAGTTGGAGCTAAACTCTCGAATTCTGCTTCTTCTATACCCATCCAC
CTCTTACCCGGCGAATATACCACGACAACGAACTCAGAATTATTACGCGATGCTTTGACATCTTCGACGACGACG
CTCTCTCCCTCTGCTGGTTTTTCCAATGCTTCATCATCGCTTTCCAATAGTCTTCCTTTGGAACTATTTCTTCAG
CCTGGAATAGCGACTTTTTCATCGCGTTTGTATTCTGGACAAACTGCATTCACAGCACTACCTGATTCCACGAAT
AATAACAATACATCGTCGTCAACGCCACTGGTTGCTGAATCGGTGGCGCTTTCGAGTAATGTGGTTGCGATAACG
ACTTCGTCGTCTAATCGATTGGTTTTATGGGATTCGATACCTGATACAGGACATCTTCCACCACCGTTCAATAAT
GCTCAACTTTCGCTTGTGGATATTCAATCAACGACATGTTCGCCTTTATGTTCTTCTTCTGGAGGAATATGTAAT
TCTCAAGGTCAATGTGTATGTCGAGATGGATTCACTGGTTCTTCTTGTGAGGAATGTTCTTCTGGACGGTTTGGT
CCGGATTGTCGGGTTTGTGGTGAGGATGATTGCGAGAAATGTGATGAAGGCGTTTCTGGGACAGGGAGATGTTTG
AAGAAGAAGAGGAGTGGGAATGATTGTAATTGTGTGAATGGGGTTTGTGGTGACGATGGGAATTGTCAGTGTACG
ACTGGGTTTACGAAGGCGGATAATGGGACTCAATGCGCGAAATGTGCTGATGGGTTTTTCTTGACTTCAAGTGGC
GATTGTAAAGGTACGTTTTTTCTTTTCGTCAAGCATTATTCTTTTTGACGCTGATTATTCTTCTTTCAGCTTGTC
AAGTCGGATGTACTAAATGCGCAGACGGTTCCGGTGATTGTCTCTCCTGCCAATCCGGTTCCACACAAAACCAGA
ACGACCGTGCTCTATGCATACCATCTACCCAAGTCACAACTACCGGAACTCAATGCCCACAACTCGCCTTCGCCA
ACGGCGACACTTGTTCCCCTTGCGCCGCTTCTTGCCAAACATGTTCCGGTGGTACCTCCAATGATTGTACTGAAT
GTGTTCAAGGACAATATATGCTCAATGGCGTTTGTGTCAAAGCGAATGGGGACGGTGTATGTGAAGGGACGAGTT
TAATTGCGGATAATAATAAGAAGGCTTGTGATAGCTGTGGTGCGAAATGCACTTCTTGCAAGATTCCGGATTTTA
GTATTGCGTCTATTGTTACGCAGCTTCAGTGCACGGGTTGTGTGCCTGGGAGTTTTCTGTCTGATGGGAAATGTG
TCGATTCGTGTCCAGATGGAACTTTCGTTTCTGCTCAGGATGGTGTGACTTGTCAAAGTATGTCTTTTTCTGCTT
GGGTTTATGATATCACGAGCTAAGGGCCCTTTTTTTAGAATGCGATTCAAGTTGTAGCACTTGTTCAGGCTCTTC
TACATTTTGCCTCTCTTGCTCCTCTCAAACACAGCTGACGTTCAACGGTGCATGCGTCGCTGCCGATTCTTGTCC
CAAATCCACTTTCGCATCGGACTCGACAACTTCCTGTATCTCTTGTCATCCCGACTGCTCCGAATGTTCCGATTC
CGGTTTCAACAAATGTACAGCATGTCCAACTGAGAGACCTGTACTCGTCAACGGACGATGTTTGTCTACGTGTTC
CAAGAACGAATATTGGGACTCGAACGCGAATGAGTGCAAGGCCTGTGATAGTTCTTGTGGAAGTTGTACTGGGCC
AGGATCGTCAAGTTGCCTTTCGTGTTCAAACGCCAATGATAGAGTTCTTCGTTCTGGTTCTTGCGTTTCTTCCTC
AAACGCTTGTTCGTCTTTGGGTAATGATACATCTGTTATCAACCCTTTAGGCGTATGTTTCGCTGAACTTGTTGT
GGCAACCGACACGAGTAATCCTGGTAAACCTGTTGATCCTGATGAGCCTGATGATCCAGGTTTAGGTGAACAACC
AGGGACAACGACAACGCGCACTGAGAAGTTGAAACTTGAGTGGTGGCAGATATTGTTGATGGCACTGGGATGTGC
GTTTATATTCCTCGCTTTCATCTGGTGTTGTTGTAGGAGGAGGAGAAAGAAGAGAAAGGAAGAGGCAAGGAGACG
TCTTCAAGGTTACGCTTTTGCCAACGTTGCTGGTTCAAACAAGCGACCTTGGTGGAGGAGCTGTGGCAGGAGGAA
GAAGAATCAAGAGATCAACGTCCATTACGATCCAGCTTTTGATCATGATGCTGCGATACGACGTAGTGGATGGAA
ACATCGTCTTGTTCGATTTGGTGAAAAGTTCTTTGGACATTCGAAATCTACTCGTGGTTATTATGCTTCTCGCTC
TTCCATTGAAATGGAAACGACGGTCAATGGGAAGTCAATTCAAGTATTTCATGATACCAAACATCGTTCGCTTTA
TCACTCACCTCCTCCTCGTTATCGATCAAATTCGGATGCTATTTCATATCGTGATCGTGATGTCGATATTGAACG
TATAGCTTCTCCTACACGACGACGAACATCCTTCCCTACTGAACCTTTTCGTCATTCCCGTTCAAGTCTGGAACA
TGACTTTAGCAGGAGGGATTCGCATGAAGGAAACGATCTACATGGCGAGAATACTCGTAGCCAATTTCAAAGGGA
ACATGAGCACCGACACCGAGAGGAAGACGGCGAAGACACAGATATGATAGAACTTATCTCTCAATATCGAAACAT
CAAAACACCTCCCGCGACGAAAAAGAATTTTCTCCACCACGGTTCTCGTTCTCGATCTACTCTGCGCAATCCCCG
TCACCACTCTAATGCTAGTGGAGCACATTTATTGGGATCACCATCGTCACGAAGCCACGAAAACGATGAAGTTGA
CGATTACTATGGTCAAGAGGAATACTATAGACGATCTTACTCAAGCACTATATCCACAGATTCGTTGTATTCCCA
AGTGACGGGTCGTACCAGGCGTACACCCGAGGCTCGGCAACGAGTACGTGATGAAGAACAAGAAGAATTTCCACC
GATACTGAAGAGCAAGTTCTCTATGAGTACCCTCGGTACCGGCAATGATATTTCACAGGATCGAAGAAAGCTCAA
GAAAAAACCTGATCAGGAACGTGGATCATCCTCATTCTGGAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail