Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|017510
Gene name
Locationscaffold_10:679159..681573
Strand+
Gene length (bp)2414
Transcript length (bp)1896
Coding sequence length (bp)1896
Protein length (aa) 632

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07731 Cu-oxidase_2 Multicopper oxidase 4.8E-35 402 517
PF00394 Cu-oxidase Multicopper oxidase 1.3E-32 158 324
PF07732 Cu-oxidase_3 Multicopper oxidase 7.8E-32 33 151

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09920|FIO1_SCHPO Iron transport multicopper oxidase fio1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fio1 PE=3 SV=1 1 607 1.0E-129
sp|Q6CII3|FET3_KLULA Iron transport multicopper oxidase FET3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FET3 PE=3 SV=1 1 609 2.0E-121
sp|P78591|FET3_CANAX Iron transport multicopper oxidase FET3 OS=Candida albicans GN=FET3 PE=3 SV=1 4 594 2.0E-121
sp|P38993|FET3_YEAST Iron transport multicopper oxidase FET3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FET3 PE=1 SV=2 1 609 2.0E-111
sp|Q96WT3|FET3_CANGA Iron transport multicopper oxidase FET3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FET3 PE=3 SV=1 11 606 1.0E-109
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09920|FIO1_SCHPO Iron transport multicopper oxidase fio1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fio1 PE=3 SV=1 1 607 1.0E-129
sp|Q6CII3|FET3_KLULA Iron transport multicopper oxidase FET3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FET3 PE=3 SV=1 1 609 2.0E-121
sp|P78591|FET3_CANAX Iron transport multicopper oxidase FET3 OS=Candida albicans GN=FET3 PE=3 SV=1 4 594 2.0E-121
sp|P38993|FET3_YEAST Iron transport multicopper oxidase FET3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FET3 PE=1 SV=2 1 609 2.0E-111
sp|Q96WT3|FET3_CANGA Iron transport multicopper oxidase FET3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FET3 PE=3 SV=1 11 606 1.0E-109
sp|P43561|FET5_YEAST Iron transport multicopper oxidase FET5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FET5 PE=1 SV=1 15 615 4.0E-101
sp|Q02081|LAC4_THACU Laccase-4 OS=Thanatephorus cucumeris GN=LCC4 PE=1 SV=1 9 511 3.0E-58
sp|Q12719|LAC4_TRAVE Laccase-4 OS=Trametes versicolor GN=LCC4 PE=3 SV=1 32 515 3.0E-53
sp|Q99055|LAC4_TRAVI Laccase-4 OS=Trametes villosa GN=LCC4 PE=3 SV=1 32 515 2.0E-52
sp|Q12541|LAC1_AGABI Laccase-1 OS=Agaricus bisporus GN=lcc1 PE=1 SV=1 21 535 9.0E-51
sp|Q12542|LAC2_AGABI Laccase-2 OS=Agaricus bisporus GN=lcc2 PE=1 SV=1 21 535 2.0E-50
sp|Q99056|LAC5_TRAVI Laccase-5 OS=Trametes villosa GN=LCC5 PE=3 SV=2 16 511 1.0E-48
sp|Q01679|LAC1_PHLRA Laccase OS=Phlebia radiata GN=LAC PE=1 SV=2 5 515 2.0E-48
sp|P78722|LAC2_PODAS Laccase-2 OS=Podospora anserina GN=LAC2 PE=2 SV=1 40 537 7.0E-48
sp|Q12717|LAC5_TRAVE Laccase-5 OS=Trametes versicolor GN=LCC5 PE=2 SV=1 16 515 1.0E-47
sp|P14133|ASO_CUCSA L-ascorbate oxidase OS=Cucumis sativus PE=1 SV=1 4 523 1.0E-46
sp|Q12718|LAC2_TRAVE Laccase-2 OS=Trametes versicolor GN=LCC2 PE=1 SV=1 16 515 1.0E-45
sp|Q12570|LAC1_BOTFU Laccase-1 OS=Botryotinia fuckeliana GN=lcc1 PE=2 SV=3 30 516 2.0E-45
sp|Q96WM9|LAC2_BOTFU Laccase-2 OS=Botryotinia fuckeliana GN=lcc2 PE=2 SV=1 14 516 1.0E-44
sp|Q99046|LAC2_TRAVI Laccase-2 OS=Trametes villosa GN=LCC2 PE=3 SV=1 16 515 6.0E-44
sp|D0VWU3|LAC1_TRAMX Laccase OS=Trametes maxima PE=1 SV=1 33 535 2.0E-43
sp|Q99044|LAC1_TRAVI Laccase-1 OS=Trametes villosa GN=LCC1 PE=3 SV=1 7 535 6.0E-43
sp|O59896|LAC1_PYCCI Laccase OS=Pycnoporus cinnabarinus GN=LCC3-1 PE=1 SV=1 7 535 7.0E-43
sp|Q03966|LAC1_CRYPA Laccase OS=Cryphonectria parasitica GN=LAC-1 PE=3 SV=1 31 537 1.0E-41
sp|Q12729|LAC1_PLEOS Laccase-1 OS=Pleurotus ostreatus GN=POX1 PE=2 SV=1 78 515 2.0E-41
sp|Q02497|LAC1_TRAHI Laccase OS=Trametes hirsuta PE=1 SV=1 32 535 3.0E-41
sp|Q40588|ASO_TOBAC L-ascorbate oxidase OS=Nicotiana tabacum GN=AAO PE=2 SV=1 24 531 3.0E-41
sp|P37064|ASO_CUCPM L-ascorbate oxidase OS=Cucurbita pepo var. melopepo PE=1 SV=1 26 526 1.0E-40
sp|Q70KY3|LAC1_MELAO Laccase-1 OS=Melanocarpus albomyces GN=LAC1 PE=1 SV=1 40 534 2.0E-40
sp|Q12739|LAC2_PLEOS Laccase-2 OS=Pleurotus ostreatus GN=POX2 PE=1 SV=1 78 515 2.0E-40
sp|P24792|ASO_CUCMA L-ascorbate oxidase OS=Cucurbita maxima GN=AAO PE=1 SV=2 26 526 5.0E-40
sp|P06811|LAC1_NEUCR Laccase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lacc PE=1 SV=3 40 576 2.0E-39
sp|Q02075|LAC2_THACU Laccase-2 OS=Thanatephorus cucumeris GN=LCC2 PE=2 SV=1 16 330 2.0E-39
sp|Q5N7A3|LAC6_ORYSJ Laccase-6 OS=Oryza sativa subsp. japonica GN=LAC6 PE=2 SV=1 48 511 3.0E-38
sp|Q1PDH6|LAC16_ARATH Laccase-16 OS=Arabidopsis thaliana GN=LAC16 PE=2 SV=2 45 514 9.0E-38
sp|O80434|LAC4_ARATH Laccase-4 OS=Arabidopsis thaliana GN=IRX12 PE=2 SV=2 45 514 5.0E-37
sp|Q2QUN2|LAC24_ORYSJ Laccase-24 OS=Oryza sativa subsp. japonica GN=LAC24 PE=2 SV=1 48 511 1.0E-36
sp|Q8RYM9|LAC2_ORYSJ Laccase-2 OS=Oryza sativa subsp. japonica GN=LAC2 PE=2 SV=1 26 514 2.0E-36
sp|Q0DHL5|LAC11_ORYSJ Putative laccase-11 OS=Oryza sativa subsp. japonica GN=LAC11 PE=5 SV=2 46 511 5.0E-36
sp|Q5N9W4|LAC5_ORYSJ Putative laccase-5 OS=Oryza sativa subsp. japonica GN=LAC5 PE=3 SV=1 20 529 1.0E-35
sp|Q8VZA1|LAC11_ARATH Laccase-11 OS=Arabidopsis thaliana GN=LAC11 PE=2 SV=1 1 514 9.0E-34
sp|Q96UM2|LAC3_BOTFU Laccase-3 (Fragment) OS=Botryotinia fuckeliana GN=lcc3 PE=3 SV=1 56 513 2.0E-33
sp|D4APX3|LAC1_ARTBC Laccase ARB_05828 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05828 PE=1 SV=1 32 515 3.0E-33
sp|Q6ID18|LAC10_ARATH Laccase-10 OS=Arabidopsis thaliana GN=LAC10 PE=2 SV=1 10 514 6.0E-33
sp|P56193|LAC1_THACU Laccase-1 OS=Thanatephorus cucumeris GN=LCC1 PE=1 SV=1 9 295 1.0E-32
sp|Q0IQU1|LAC22_ORYSJ Laccase-22 OS=Oryza sativa subsp. japonica GN=LAC22 PE=2 SV=2 46 514 2.0E-32
sp|Q941X2|LAC3_ORYSJ Laccase-3 OS=Oryza sativa subsp. japonica GN=LAC3 PE=2 SV=1 48 514 3.0E-32
sp|Q9SR40|LAC7_ARATH Laccase-7 OS=Arabidopsis thaliana GN=LAC7 PE=2 SV=1 8 514 4.0E-32
sp|Q02079|LAC3_THACU Laccase-3 OS=Thanatephorus cucumeris GN=LCC3 PE=2 SV=1 9 295 7.0E-32
sp|Q9LMS3|LAC1_ARATH Laccase-1 OS=Arabidopsis thaliana GN=LAC1 PE=2 SV=1 46 514 2.0E-31
sp|Q2R0L2|LAC19_ORYSJ Laccase-19 OS=Oryza sativa subsp. japonica GN=LAC19 PE=2 SV=1 47 514 2.0E-30
sp|A2Y9C5|LAC19_ORYSI Putative laccase-19 OS=Oryza sativa subsp. indica GN=LAC19 PE=3 SV=1 47 514 3.0E-30
sp|Q10ND7|LAC10_ORYSJ Laccase-10 OS=Oryza sativa subsp. japonica GN=LAC10 PE=2 SV=1 24 523 5.0E-30
sp|Q69L99|LAC14_ORYSJ Laccase-14 OS=Oryza sativa subsp. japonica GN=LAC14 PE=3 SV=1 37 511 5.0E-30
sp|Q9ZPY2|LAC6_ARATH Laccase-6 OS=Arabidopsis thaliana GN=LAC6 PE=2 SV=1 48 533 6.0E-30
sp|Q9FLB5|LAC12_ARATH Laccase-12 OS=Arabidopsis thaliana GN=LAC12 PE=2 SV=1 1 514 7.0E-30
sp|Q99049|LAC3_TRAVI Laccase-3 OS=Trametes villosa GN=LCC3 PE=3 SV=1 13 300 1.0E-29
sp|A2Y9C2|LAC20_ORYSI Laccase-20 OS=Oryza sativa subsp. indica GN=LAC20 PE=3 SV=1 47 514 8.0E-29
sp|Q9LYQ2|LAC13_ARATH Laccase-13 OS=Arabidopsis thaliana GN=LAC13 PE=2 SV=1 49 514 2.0E-28
sp|Q84J37|LAC15_ARATH Laccase-15 OS=Arabidopsis thaliana GN=TT10 PE=1 SV=1 46 514 8.0E-28
sp|Q04399|GMC1_YEAST Putative multicopper oxidase GMC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GMC1 PE=1 SV=1 37 517 3.0E-26
sp|Q9FY79|LAC14_ARATH Laccase-14 OS=Arabidopsis thaliana GN=LAC14 PE=2 SV=1 47 514 4.0E-26
sp|Q2QZ80|LAC21_ORYSJ Laccase-21 OS=Oryza sativa subsp. japonica GN=LAC21 PE=2 SV=1 45 514 6.0E-25
sp|Q9SU40|SKU5_ARATH Monocopper oxidase-like protein SKU5 OS=Arabidopsis thaliana GN=SKU5 PE=1 SV=1 31 495 2.0E-24
sp|Q7XE50|LAC16_ORYSJ Putative laccase-16 OS=Oryza sativa subsp. japonica GN=LAC16 PE=5 SV=1 83 514 3.0E-23
sp|Q6Z8L2|LAC9_ORYSJ Putative laccase-9 OS=Oryza sativa subsp. japonica GN=LAC9 PE=3 SV=1 16 294 4.0E-23
sp|Q9FJD5|LAC17_ARATH Laccase-17 OS=Arabidopsis thaliana GN=LAC17 PE=2 SV=1 46 511 1.0E-22
sp|Q2R0L0|LAC20_ORYSJ Laccase-20 OS=Oryza sativa subsp. japonica GN=LAC20 PE=2 SV=1 47 514 2.0E-22
sp|P12374|COPA_PSEUB Copper resistance protein A OS=Pseudomonas syringae pv. tomato GN=copA PE=1 SV=1 46 285 1.0E-21
sp|Q8VXX5|SKS1_ARATH Monocopper oxidase-like protein SKS1 OS=Arabidopsis thaliana GN=SKS1 PE=1 SV=1 4 513 2.0E-21
sp|Q9FHN6|SKS2_ARATH Monocopper oxidase-like protein SKS2 OS=Arabidopsis thaliana GN=SKS2 PE=1 SV=1 23 515 2.0E-21
sp|Q0JHP8|LAC8_ORYSJ Laccase-8 OS=Oryza sativa subsp. japonica GN=LAC8 PE=3 SV=2 52 293 7.0E-21
sp|Q0IP28|LAC25_ORYSJ Laccase-25 OS=Oryza sativa subsp. japonica GN=LAC25 PE=3 SV=1 48 287 1.0E-20
sp|Q53LU4|LAC18_ORYSJ Laccase-18 OS=Oryza sativa subsp. japonica GN=LAC18 PE=2 SV=1 47 285 1.0E-20
sp|Q00624|ASOL_BRANA L-ascorbate oxidase homolog OS=Brassica napus GN=Bp10 PE=2 SV=1 31 495 5.0E-20
sp|P59571|COPA_PSESM Copper resistance protein A homolog OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=copA PE=3 SV=1 46 285 7.0E-20
sp|Q47452|PCOA_ECOLX Copper resistance protein A OS=Escherichia coli GN=pcoA PE=3 SV=1 17 296 1.0E-19
sp|A2XCN6|LAC18_ORYSI Putative laccase-18 OS=Oryza sativa subsp. indica GN=LAC18 PE=3 SV=1 47 287 1.0E-19
sp|Q5N9X2|LAC4_ORYSJ Laccase-4 OS=Oryza sativa subsp. japonica GN=LAC4 PE=2 SV=1 46 288 5.0E-19
sp|Q5N7B4|LAC7_ORYSJ Laccase-7 OS=Oryza sativa subsp. japonica GN=LAC7 PE=2 SV=1 48 311 2.0E-18
sp|Q339K6|LAC15_ORYSJ Laccase-15 OS=Oryza sativa subsp. japonica GN=LAC15 PE=2 SV=1 51 300 6.0E-18
sp|Q0DHL2|LAC12_ORYSJ Laccase-12/13 OS=Oryza sativa subsp. japonica GN=LAC12 PE=2 SV=1 46 288 7.0E-18
sp|Q5ZCW1|LAC1_ORYSJ Putative laccase-1 OS=Oryza sativa subsp. japonica GN=LAC1 PE=3 SV=1 25 294 2.0E-17
sp|I6WZK7|MMCO_MYCTU Multicopper oxidase MmcO OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmcO PE=1 SV=1 54 287 3.0E-17
sp|O81081|LAC2_ARATH Laccase-2 OS=Arabidopsis thaliana GN=LAC2 PE=2 SV=1 46 288 1.0E-15
sp|Q02075|LAC2_THACU Laccase-2 OS=Thanatephorus cucumeris GN=LCC2 PE=2 SV=1 341 536 7.0E-15
sp|Q9LFD1|LAC9_ARATH Laccase-9 OS=Arabidopsis thaliana GN=LAC9 PE=2 SV=1 51 287 7.0E-15
sp|Q2RBK2|LAC17_ORYSJ Putative laccase-17 OS=Oryza sativa subsp. japonica GN=LAC17 PE=3 SV=1 48 286 7.0E-15
sp|Q9SIY8|LAC5_ARATH Laccase-5 OS=Arabidopsis thaliana GN=LAC5 PE=2 SV=1 49 287 1.0E-14
sp|P29162|ASOL_TOBAC L-ascorbate oxidase homolog OS=Nicotiana tabacum PE=2 SV=1 31 495 1.0E-14
sp|Q9LFD2|LAC8_ARATH Laccase-8 OS=Arabidopsis thaliana GN=LAC8 PE=2 SV=1 52 287 3.0E-14
sp|Q2QYS3|LAC23_ORYSJ Laccase-23 OS=Oryza sativa subsp. japonica GN=LAC23 PE=3 SV=1 46 286 4.0E-14
sp|O81081|LAC2_ARATH Laccase-2 OS=Arabidopsis thaliana GN=LAC2 PE=2 SV=1 380 526 9.0E-14
sp|Q56YT0|LAC3_ARATH Laccase-3 OS=Arabidopsis thaliana GN=LAC3 PE=2 SV=2 49 287 2.0E-13
sp|P17489|LAC1_EMENI Laccase-1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=yA PE=2 SV=3 32 516 3.0E-13
sp|Q339K6|LAC15_ORYSJ Laccase-15 OS=Oryza sativa subsp. japonica GN=LAC15 PE=2 SV=1 417 514 4.0E-13
sp|Q0DHL2|LAC12_ORYSJ Laccase-12/13 OS=Oryza sativa subsp. japonica GN=LAC12 PE=2 SV=1 366 511 4.0E-13
sp|Q56YT0|LAC3_ARATH Laccase-3 OS=Arabidopsis thaliana GN=LAC3 PE=2 SV=2 409 525 6.0E-13
sp|Q0IP28|LAC25_ORYSJ Laccase-25 OS=Oryza sativa subsp. japonica GN=LAC25 PE=3 SV=1 385 513 3.0E-12
sp|Q5N9X2|LAC4_ORYSJ Laccase-4 OS=Oryza sativa subsp. japonica GN=LAC4 PE=2 SV=1 409 511 2.0E-11
sp|Q02079|LAC3_THACU Laccase-3 OS=Thanatephorus cucumeris GN=LCC3 PE=2 SV=1 341 539 3.0E-11
sp|Q9LFD1|LAC9_ARATH Laccase-9 OS=Arabidopsis thaliana GN=LAC9 PE=2 SV=1 385 533 6.0E-11
sp|Q2QYS3|LAC23_ORYSJ Laccase-23 OS=Oryza sativa subsp. japonica GN=LAC23 PE=3 SV=1 366 525 8.0E-11
sp|Q6Z8L2|LAC9_ORYSJ Putative laccase-9 OS=Oryza sativa subsp. japonica GN=LAC9 PE=3 SV=1 385 514 1.0E-10
sp|Q2RBK2|LAC17_ORYSJ Putative laccase-17 OS=Oryza sativa subsp. japonica GN=LAC17 PE=3 SV=1 366 525 1.0E-10
sp|Q9SIY8|LAC5_ARATH Laccase-5 OS=Arabidopsis thaliana GN=LAC5 PE=2 SV=1 385 514 1.0E-10
sp|Q5N7B4|LAC7_ORYSJ Laccase-7 OS=Oryza sativa subsp. japonica GN=LAC7 PE=2 SV=1 415 511 3.0E-10
sp|Q5ZCW1|LAC1_ORYSJ Putative laccase-1 OS=Oryza sativa subsp. japonica GN=LAC1 PE=3 SV=1 373 514 9.0E-10
sp|Q9LFD2|LAC8_ARATH Laccase-8 OS=Arabidopsis thaliana GN=LAC8 PE=2 SV=1 385 533 1.0E-09
sp|P56193|LAC1_THACU Laccase-1 OS=Thanatephorus cucumeris GN=LCC1 PE=1 SV=1 373 517 3.0E-09
sp|Q0JHP8|LAC8_ORYSJ Laccase-8 OS=Oryza sativa subsp. japonica GN=LAC8 PE=3 SV=2 419 511 6.0E-09
sp|A2XCN6|LAC18_ORYSI Putative laccase-18 OS=Oryza sativa subsp. indica GN=LAC18 PE=3 SV=1 366 514 7.0E-09
sp|Q53LU4|LAC18_ORYSJ Laccase-18 OS=Oryza sativa subsp. japonica GN=LAC18 PE=2 SV=1 366 514 9.0E-09
sp|I6WZK7|MMCO_MYCTU Multicopper oxidase MmcO OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmcO PE=1 SV=1 423 513 9.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005507 copper ion binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0046914 transition metal ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 574 596 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|017510
MTSAFFYPTILLLSWLSLAPSVLAGVQEVWWDITYTNANPDGLFDRRVIGINGTWPPPPLEVNDDDILVIHAHNS
LDKPTSLHNHGMFFNSTPWMDGAVGVTECGIPPNGDFTYVVPVNTSGQRGTYWTHAHNMGEYMDGLRTPLVLHPQ
NEVHSYDEEFTVVLGDWYHQEYDGLRDHFLSIANPGGAEPVPESGLIYFAQNSNYLGPVSGTSSSAVGFNENATL
PFEPGKTYRLRIVNTSGFAGFFFWIDGHEMRIIEVDGTDVEESPIDLIGLSVAQRYSILVTARNDTSSNWAIHAN
FDVDMFDSIPPALNPNISSSITYDSSSSITDLGTVDAYDYVDDISLVPVVKVPQPRATKTIELEIIFETMDDGTN
RGTFNSVVYNFPQTPTLFSELTLGENSTVEQAYGPQSFVLDHLEVVDIVLKNSDAGKHPFHIHGHHVMLVGRSED
YTSTDPSLNPPLVEGQANPMRRDTVLVPSMGSVTLRLVADNPGAWIFHCHIEWHLDAGLAMQLIEAPLIAGQLQS
QLPQQAKDNCQALGRPFSGNAVGLASATDLKGLTIGPFPQKLGWLPKGIGAMFGCVFTAALGMASVVWYTFGGHI
SEEDIEEEIRAKISEKAKRGRFFGLLRRQEA*
Coding >AgabiH97|017510
ATGACTTCCGCTTTCTTTTATCCTACGATCCTACTCCTCTCCTGGCTCAGCCTGGCACCTTCGGTGCTTGCAGGA
GTGCAAGAGGTATGGTGGGATATAACCTACACTAATGCGAATCCAGACGGTCTGTTCGACCGTCGTGTTATCGGC
ATCAATGGAACCTGGCCACCTCCACCACTTGAGGTGAACGATGATGACATCCTTGTTATCCACGCCCACAACAGT
TTGGACAAGCCAACGAGCTTGCACAATCATGGGATGTTCTTTAATTCTACCCCGTGGATGGATGGCGCCGTGGGT
GTCACCGAATGTGGCATTCCTCCGAATGGTGACTTCACATATGTTGTGCCTGTCAACACGTCTGGACAAAGGGGC
ACATACTGGACGCATGCCCATAACATGGGTGAATATATGGACGGATTGCGGACACCGCTCGTCCTTCACCCACAA
AATGAAGTGCATTCCTATGACGAAGAATTTACCGTTGTTCTCGGTGACTGGTACCACCAGGAGTATGATGGTCTT
CGGGACCACTTCCTCAGCATCGCCAATCCTGGCGGCGCGGAACCTGTCCCTGAATCTGGCCTGATATACTTTGCT
CAAAACAGCAATTACCTTGGCCCCGTTTCCGGCACCTCTTCTTCCGCTGTAGGATTCAACGAAAACGCGACTTTA
CCGTTCGAACCTGGAAAAACATATCGTCTACGAATTGTCAATACTTCTGGTTTTGCCGGTTTCTTTTTCTGGATC
GATGGCCATGAAATGCGTATCATCGAGGTTGATGGTACAGATGTCGAGGAGTCACCCATTGATCTCATCGGTCTC
TCTGTTGCGCAACGATATTCTATCCTTGTGACTGCCAGAAACGACACGTCAAGCAACTGGGCTATCCATGCGAAC
TTTGATGTAGACATGTTCGATTCCATTCCCCCAGCCTTAAATCCAAATATATCTTCCTCTATCACGTATGACTCA
TCGTCATCGATTACGGATTTGGGTACCGTGGATGCATATGACTACGTCGACGATATTTCGCTCGTACCAGTGGTG
AAGGTCCCTCAACCTAGAGCGACAAAGACCATCGAACTTGAAATCATTTTCGAAACCATGGACGACGGTACCAAC
AGAGGCACATTTAATTCTGTGGTATATAATTTCCCTCAAACGCCAACCCTCTTTTCGGAGTTGACTTTGGGAGAA
AATTCGACTGTAGAGCAAGCATATGGCCCTCAGAGCTTTGTCCTCGACCACCTGGAGGTAGTTGACATTGTACTC
AAGAATTCGGATGCCGGAAAGCATCCTTTCCATATACACGGTCACCACGTGATGCTGGTCGGGCGGTCAGAAGAT
TATACGTCGACGGATCCGTCGCTAAATCCACCTTTAGTCGAAGGTCAAGCTAATCCCATGCGTCGAGACACGGTA
CTGGTCCCATCAATGGGCTCCGTTACATTGAGGCTCGTGGCCGATAACCCCGGCGCATGGATTTTCCATTGTCAC
ATTGAATGGCATTTGGACGCTGGCCTGGCAATGCAACTGATTGAAGCGCCATTGATTGCTGGACAACTTCAAAGC
CAGCTACCGCAACAGGCAAAAGACAACTGTCAAGCCCTTGGAAGACCTTTTTCTGGAAATGCGGTTGGACTTGCT
TCGGCAACTGACCTTAAAGGCTTGACTATCGGTCCGTTCCCCCAGAAGTTGGGCTGGCTCCCGAAAGGAATTGGT
GCAATGTTTGGATGTGTGTTTACAGCGGCACTCGGCATGGCATCTGTTGTGTGGTACACATTTGGCGGCCATATA
TCGGAGGAAGATATAGAAGAAGAGATCAGGGCGAAGATTAGTGAGAAGGCGAAAAGAGGCCGTTTCTTCGGATTG
CTTCGACGCCAAGAAGCGTAA
Transcript >AgabiH97|017510
ATGACTTCCGCTTTCTTTTATCCTACGATCCTACTCCTCTCCTGGCTCAGCCTGGCACCTTCGGTGCTTGCAGGA
GTGCAAGAGGTATGGTGGGATATAACCTACACTAATGCGAATCCAGACGGTCTGTTCGACCGTCGTGTTATCGGC
ATCAATGGAACCTGGCCACCTCCACCACTTGAGGTGAACGATGATGACATCCTTGTTATCCACGCCCACAACAGT
TTGGACAAGCCAACGAGCTTGCACAATCATGGGATGTTCTTTAATTCTACCCCGTGGATGGATGGCGCCGTGGGT
GTCACCGAATGTGGCATTCCTCCGAATGGTGACTTCACATATGTTGTGCCTGTCAACACGTCTGGACAAAGGGGC
ACATACTGGACGCATGCCCATAACATGGGTGAATATATGGACGGATTGCGGACACCGCTCGTCCTTCACCCACAA
AATGAAGTGCATTCCTATGACGAAGAATTTACCGTTGTTCTCGGTGACTGGTACCACCAGGAGTATGATGGTCTT
CGGGACCACTTCCTCAGCATCGCCAATCCTGGCGGCGCGGAACCTGTCCCTGAATCTGGCCTGATATACTTTGCT
CAAAACAGCAATTACCTTGGCCCCGTTTCCGGCACCTCTTCTTCCGCTGTAGGATTCAACGAAAACGCGACTTTA
CCGTTCGAACCTGGAAAAACATATCGTCTACGAATTGTCAATACTTCTGGTTTTGCCGGTTTCTTTTTCTGGATC
GATGGCCATGAAATGCGTATCATCGAGGTTGATGGTACAGATGTCGAGGAGTCACCCATTGATCTCATCGGTCTC
TCTGTTGCGCAACGATATTCTATCCTTGTGACTGCCAGAAACGACACGTCAAGCAACTGGGCTATCCATGCGAAC
TTTGATGTAGACATGTTCGATTCCATTCCCCCAGCCTTAAATCCAAATATATCTTCCTCTATCACGTATGACTCA
TCGTCATCGATTACGGATTTGGGTACCGTGGATGCATATGACTACGTCGACGATATTTCGCTCGTACCAGTGGTG
AAGGTCCCTCAACCTAGAGCGACAAAGACCATCGAACTTGAAATCATTTTCGAAACCATGGACGACGGTACCAAC
AGAGGCACATTTAATTCTGTGGTATATAATTTCCCTCAAACGCCAACCCTCTTTTCGGAGTTGACTTTGGGAGAA
AATTCGACTGTAGAGCAAGCATATGGCCCTCAGAGCTTTGTCCTCGACCACCTGGAGGTAGTTGACATTGTACTC
AAGAATTCGGATGCCGGAAAGCATCCTTTCCATATACACGGTCACCACGTGATGCTGGTCGGGCGGTCAGAAGAT
TATACGTCGACGGATCCGTCGCTAAATCCACCTTTAGTCGAAGGTCAAGCTAATCCCATGCGTCGAGACACGGTA
CTGGTCCCATCAATGGGCTCCGTTACATTGAGGCTCGTGGCCGATAACCCCGGCGCATGGATTTTCCATTGTCAC
ATTGAATGGCATTTGGACGCTGGCCTGGCAATGCAACTGATTGAAGCGCCATTGATTGCTGGACAACTTCAAAGC
CAGCTACCGCAACAGGCAAAAGACAACTGTCAAGCCCTTGGAAGACCTTTTTCTGGAAATGCGGTTGGACTTGCT
TCGGCAACTGACCTTAAAGGCTTGACTATCGGTCCGTTCCCCCAGAAGTTGGGCTGGCTCCCGAAAGGAATTGGT
GCAATGTTTGGATGTGTGTTTACAGCGGCACTCGGCATGGCATCTGTTGTGTGGTACACATTTGGCGGCCATATA
TCGGAGGAAGATATAGAAGAAGAGATCAGGGCGAAGATTAGTGAGAAGGCGAAAAGAGGCCGTTTCTTCGGATTG
CTTCGACGCCAAGAAGCGTAA
Gene >AgabiH97|017510
ATGACTTCCGCTTTCTTTTATCCTACGATCCTACTCCTCTCCTGGCTCAGCCTGGCACCTTCGGTGCTTGCAGGA
GTGCAAGAGGTATGGTGGGATATAACCTACACTAATGCGAATCCAGACGGTCTGTTCGACCGTCGTGTTATCGGC
ATCAATGGAACCTGGCCGTAAGACACGTTCCCGACGCGTTACTCTTCTCACGCTCACGGCTTCCTTAGACCTCCA
CCACTTGAGGTGAACGATGATGACATCCTTGTTATCCACGCCCACAACAGTTTGGACAAGCCAACGAGCTTGCAC
AATCATGGGATGTTCTTTAATTCTACCCCGTGGATGGATGGCGCCGTGGGTGTCACCGAATGGTTTGTGGTCCTT
TATGTCGTCGCATCAGGTCTTATATTTTTTTTGTTTTCTCAGTGGCATTCCTCCGAATGGTGACTTCACATATGT
TGTGCCTGTCAACACGTCTGGACAAAGGGGCACATACTGGACGCATGCCCATAACATGGTCAGTGCATTTAATAT
TTCATATGTATCTCAGAAACCTAATAAAGGAGGCAGGGTGAATATATGGACGGATTGCGGACACCGCTCGTCCTT
CACCCACAAAATGAAGTGCATTCCTATGACGAAGAATTTACCGTTGTTCTCGGTGACTGGTACCACCAGGAGTAT
GATGGTCTTCGGGACCACTTCCTCAGCATCGCCAATCCTGGCGGCGCGGAACCTGTCCCTGGTAAGCTGGGCATA
CATTCTCGCATTTTCAGCACAGTAATGTAATATAACGATAGAATCTGGCCTGATATACTTTGCTCAAAACAGCAA
TTACCTTGGCCCCGTTTCCGGCACCTCTTCTTCCGCTGTAGGATTCAACGAAAACGCGACTTTACCGTTCGAACC
TGGAAAAACATATCGTCTACGAATTGTCAATACTTCTGGTTTTGCCGGTTTCTTTTTCTGGATCGATGGCCATGA
AATGCGTATCATCGAGGTTGATGGTGTAGGTTGACTTTTTCCTCGTTGCCTGGCCATTCAACCCTTACGCAATCT
TATTTAGACAGATGTCGAGGAGTCACCCATTGATCTCATCGGTCTCTCTGTTGCGCAACGATATTCTATCCTTGT
GACTGCCAGAAACGACACGTCAAGCAACTGGGCTATCCATGCGAACTTTGATGTAGACATGTTCGATTCCATTCC
CCCAGCCTTAAATCCAAGTAAGCCGTTTCGTCATGTCTTCATCCACCAAACTTTGACGCAAAATGATTTTTAGAT
ATATCTTCCTCTATCACGTATGACTCATCGTCATCGATTACGGATTTGGGTACCGTGGATGCATATGACTACGTC
GACGATATTTCGCTCGTACCAGTGGTGAAGGTCCCTCAACCTAGAGCGACAAAGACCATCGAACTTGAAATCATT
TTCGAAACCATGGACGACGGTACCAACAGAGGCACATTTAATTCTGTGGTATATAATTTCCCTCAAACGCCAACC
CTCTTTTCGGAGTTGACTTTGGGAGAAAATTCGACTGTAGAGCAAGCATATGGCCCTCAGAGCTTTGTCCTCGAC
CACCTGGAGGTAGTTGACATTGTACTCAAGAATTCGGATGCCGGAAAGCATCCTTTGTAAGTTTCTTCTCCAGTC
GACATATGCTCTCTGAGCTGATGCGAGTTTTTCCAACTCATGGCAGCCATATACACGGTCACCACGTGATGCTGG
TCGGGCGGTCAGAAGATTATACGTCGACGGATCCGTCGCTAAATCCACCTTTAGTCGAAGGTCAAGCTAATCCCA
TGCGTCGAGACACGGTACTGGTCCCATCAATGGGCTCCGTTACATTGAGGCTCGTGGCCGATAACCCCGGCGCAT
GGATTTTCCATTGTAAGTTTTGGATGAATTATTTCTCATTCCATCATCGGTCAAGTGATTGACAACCTTTCTTTA
TCCAAGGTCACATTGAATGGCATTTGGACGCTGGCCTGGCAATGCAACTGATTGAAGCGCCATTGATTGCTGGAC
AACTTCAAAGCCAGCTACCGCAACAGGCAAAAGACAACTGTCAAGCCCTTGGAAGACCTTTTTCTGGAAATGCGG
TTGGACTTGCTTCGGCAACTGACCTTAAAGGCTTGACTATCGGTCCGTTCCCCCAGAAGTTGGGCTGGCTCCCGA
AAGGAATTGGTGCAATGTTTGGGTAAGCGTTTGCTTTTTGTAAGCTGATGGATTCAAGCTGACGAAATGAACTTT
AAAGATGTGTGTTTACAGCGGCACTCGGCATGGCATCTGTTGTGTGGTACACATTTGGCGGCCATATATCGGAGG
AAGATATAGAAGAAGAGATCAGGGCGAAGATTAGTGAGAAGGCGAAAAGAGGCCGTTTCTTCGGATTGCTTCGAC
GCCAAGAAGCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail