Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|017500
Gene name
Locationscaffold_10:676906..678585
Strand-
Gene length (bp)1679
Transcript length (bp)1188
Coding sequence length (bp)1188
Protein length (aa) 396

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03239 FTR1 Iron permease FTR1 family 6.9E-66 8 351

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40088|FTR1_YEAST Plasma membrane iron permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FTR1 PE=1 SV=1 16 353 3.0E-77
sp|P38310|FTH1_YEAST Iron transporter FTH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FTH1 PE=1 SV=2 3 348 5.0E-70
sp|Q09919|FIP1_SCHPO Plasma membrane iron permease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fip1 PE=1 SV=1 1 350 2.0E-69
sp|Q0T618|EFEU_SHIF8 Ferrous iron permease EfeU OS=Shigella flexneri serotype 5b (strain 8401) GN=efeU PE=3 SV=2 122 266 7.0E-10
sp|Q83LK5|EFEU_SHIFL Ferrous iron permease EfeU OS=Shigella flexneri GN=efeU PE=3 SV=2 122 266 5.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40088|FTR1_YEAST Plasma membrane iron permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FTR1 PE=1 SV=1 16 353 3.0E-77
sp|P38310|FTH1_YEAST Iron transporter FTH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FTH1 PE=1 SV=2 3 348 5.0E-70
sp|Q09919|FIP1_SCHPO Plasma membrane iron permease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fip1 PE=1 SV=1 1 350 2.0E-69
sp|Q0T618|EFEU_SHIF8 Ferrous iron permease EfeU OS=Shigella flexneri serotype 5b (strain 8401) GN=efeU PE=3 SV=2 122 266 7.0E-10
sp|Q83LK5|EFEU_SHIFL Ferrous iron permease EfeU OS=Shigella flexneri GN=efeU PE=3 SV=2 122 266 5.0E-09
sp|Q1CHD3|EFEU_YERPN Ferrous iron permease EfeU OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=efeU PE=3 SV=1 122 266 5.0E-09
sp|Q0WFU0|EFEU_YERPE Ferrous iron permease EfeU OS=Yersinia pestis GN=efeU PE=3 SV=1 122 266 5.0E-09
sp|Q1C8M3|EFEU_YERPA Ferrous iron permease EfeU OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=efeU PE=3 SV=1 122 266 5.0E-09
sp|Q66BP6|EFEU_YERPS Ferrous iron permease EfeU OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=efeU PE=3 SV=1 122 266 6.0E-09
sp|Q3Z398|EFEU_SHISS Ferrous iron permease EfeU OS=Shigella sonnei (strain Ss046) GN=efeU PE=3 SV=2 122 266 1.0E-08
sp|Q8XAS8|EFEU_ECO57 Ferrous iron permease EfeU OS=Escherichia coli O157:H7 GN=efeU PE=1 SV=3 122 266 1.0E-08
sp|Q1RDK0|EFEU_ECOUT Ferrous iron permease EfeU OS=Escherichia coli (strain UTI89 / UPEC) GN=efeU PE=3 SV=2 122 266 1.0E-08
sp|Q0TJ50|EFEU_ECOL5 Ferrous iron permease EfeU OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=efeU PE=3 SV=1 122 266 1.0E-08
sp|P75901|EFEU_ECOLI Putative inactive ferrous iron permease EfeU OS=Escherichia coli (strain K12) GN=efeU PE=5 SV=2 122 266 1.0E-08
sp|Q8FJ36|EFEU_ECOL6 Ferrous iron permease EfeU OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=efeU PE=1 SV=2 122 266 1.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005381 iron ion transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0033573 high-affinity iron permease complex Yes
GO:0034755 iron ion transmembrane transport Yes
GO:0005575 cellular_component No
GO:0098660 inorganic ion transmembrane transport No
GO:0098796 membrane protein complex No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0034220 ion transmembrane transport No
GO:0008150 biological_process No
GO:0030001 metal ion transport No
GO:0046915 transition metal ion transmembrane transporter activity No
GO:0051179 localization No
GO:0000041 transition metal ion transport No
GO:0051234 establishment of localization No
GO:0046873 metal ion transmembrane transporter activity No
GO:0006826 iron ion transport No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:1905862 ferroxidase complex No
GO:0006812 cation transport No
GO:1990204 oxidoreductase complex No
GO:0015075 ion transmembrane transporter activity No
GO:0009987 cellular process No
GO:0008324 cation transmembrane transporter activity No
GO:0032991 protein-containing complex No
GO:0055085 transmembrane transport No
GO:0098662 inorganic cation transmembrane transport No
GO:1990351 transporter complex No
GO:1902495 transmembrane transporter complex No
GO:0003674 molecular_function No
GO:0098797 plasma membrane protein complex No
GO:0098655 cation transmembrane transport No
GO:0022857 transmembrane transporter activity No
GO:1902494 catalytic complex No
GO:0006811 ion transport No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 90 112 22
3 127 149 22
4 178 200 22
5 210 229 19
6 236 258 22
7 322 344 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|017500
MAKNVFSVPIFIIVFRETLEAAIIISVLLSLVEQLITSRVASSSVVPSNEGTRHSDADSKDAADIRLPTTLVEDD
SIQRRRVLRRMRIQIFLGAGLGLFLAIAIGAAFIAVWFTKASDLWAKAEDLWEGIFNVIASLMIFIMGVTMLKID
SAKVKWRVKLEKAFDGSQTDKKAKTGKWLLFVLPMVTLLREGLEAVVFVGGVSLGQPATSIPIAAIVGIVCGVVF
GYLIYQFASRTALTVFLVVMTNFLLLVGAGLFSKSIGNFEQYSFNKLLGADVDDAGGTGPGSYRVQGNVWHIDCC
SPENNTDGWTIFNAIFGWSNNGSLGTILSYVFYWVAVMAVLVYMKFKEGRTKIFNHESSISKVRRERKEEKAALY
DLEAKEKQETPGLGIGELPR*
Coding >AgabiH97|017500
ATGGCGAAAAATGTCTTCTCGGTTCCCATCTTCATTATCGTCTTTCGAGAGACGTTGGAGGCTGCAATCATCATC
TCCGTCTTACTGAGCCTTGTCGAACAGCTTATAACAAGTAGAGTAGCCTCCTCCTCGGTGGTTCCGTCCAACGAG
GGCACGCGACATTCGGACGCTGATAGCAAGGATGCTGCTGACATCCGTTTGCCCACTACACTTGTCGAAGACGAC
TCGATCCAACGAAGAAGGGTTCTCAGACGAATGCGCATTCAGATATTCCTTGGCGCGGGTCTGGGTCTGTTCCTT
GCCATCGCCATCGGTGCTGCGTTTATCGCCGTCTGGTTCACAAAGGCAAGCGACCTCTGGGCAAAGGCCGAAGAT
CTTTGGGAAGGTATCTTCAACGTAATCGCCTCACTCATGATTTTCATCATGGGAGTCACCATGTTGAAGATAGAT
AGTGCAAAAGTGAAATGGAGAGTCAAGCTTGAGAAGGCCTTCGATGGATCCCAAACGGATAAGAAAGCGAAGACC
GGGAAATGGTTGCTCTTCGTGCTTCCCATGGTGACACTATTGCGTGAAGGCTTAGAAGCTGTGGTTTTCGTGGGT
GGTGTATCACTCGGCCAGCCGGCAACCTCAATACCTATTGCCGCTATCGTCGGCATTGTCTGCGGCGTCGTCTTT
GGATACCTCATCTATCAGTTCGCCAGCAGGACAGCATTGACGGTCTTCCTTGTCGTAATGACAAACTTCCTCCTA
CTCGTTGGAGCGGGACTTTTCAGCAAAAGTATTGGAAACTTTGAACAGTACTCCTTCAACAAACTTCTAGGTGCC
GACGTCGACGATGCCGGAGGAACAGGCCCTGGTTCCTACCGTGTTCAGGGAAACGTCTGGCATATTGACTGCTGT
TCACCGGAAAATAACACAGACGGATGGACAATTTTCAACGCCATTTTCGGTTGGTCTAACAACGGCTCTCTTGGA
ACTATACTTTCATATGTGTTCTATTGGGTTGCCGTTATGGCCGTCCTGGTCTATATGAAATTCAAAGAGGGCCGC
ACGAAAATCTTCAATCACGAGTCTTCAATTTCAAAAGTCAGAAGAGAGCGGAAGGAAGAAAAGGCTGCTCTCTAC
GACCTCGAAGCTAAGGAGAAGCAAGAAACACCCGGGTTGGGAATTGGCGAATTGCCAAGGTAA
Transcript >AgabiH97|017500
ATGGCGAAAAATGTCTTCTCGGTTCCCATCTTCATTATCGTCTTTCGAGAGACGTTGGAGGCTGCAATCATCATC
TCCGTCTTACTGAGCCTTGTCGAACAGCTTATAACAAGTAGAGTAGCCTCCTCCTCGGTGGTTCCGTCCAACGAG
GGCACGCGACATTCGGACGCTGATAGCAAGGATGCTGCTGACATCCGTTTGCCCACTACACTTGTCGAAGACGAC
TCGATCCAACGAAGAAGGGTTCTCAGACGAATGCGCATTCAGATATTCCTTGGCGCGGGTCTGGGTCTGTTCCTT
GCCATCGCCATCGGTGCTGCGTTTATCGCCGTCTGGTTCACAAAGGCAAGCGACCTCTGGGCAAAGGCCGAAGAT
CTTTGGGAAGGTATCTTCAACGTAATCGCCTCACTCATGATTTTCATCATGGGAGTCACCATGTTGAAGATAGAT
AGTGCAAAAGTGAAATGGAGAGTCAAGCTTGAGAAGGCCTTCGATGGATCCCAAACGGATAAGAAAGCGAAGACC
GGGAAATGGTTGCTCTTCGTGCTTCCCATGGTGACACTATTGCGTGAAGGCTTAGAAGCTGTGGTTTTCGTGGGT
GGTGTATCACTCGGCCAGCCGGCAACCTCAATACCTATTGCCGCTATCGTCGGCATTGTCTGCGGCGTCGTCTTT
GGATACCTCATCTATCAGTTCGCCAGCAGGACAGCATTGACGGTCTTCCTTGTCGTAATGACAAACTTCCTCCTA
CTCGTTGGAGCGGGACTTTTCAGCAAAAGTATTGGAAACTTTGAACAGTACTCCTTCAACAAACTTCTAGGTGCC
GACGTCGACGATGCCGGAGGAACAGGCCCTGGTTCCTACCGTGTTCAGGGAAACGTCTGGCATATTGACTGCTGT
TCACCGGAAAATAACACAGACGGATGGACAATTTTCAACGCCATTTTCGGTTGGTCTAACAACGGCTCTCTTGGA
ACTATACTTTCATATGTGTTCTATTGGGTTGCCGTTATGGCCGTCCTGGTCTATATGAAATTCAAAGAGGGCCGC
ACGAAAATCTTCAATCACGAGTCTTCAATTTCAAAAGTCAGAAGAGAGCGGAAGGAAGAAAAGGCTGCTCTCTAC
GACCTCGAAGCTAAGGAGAAGCAAGAAACACCCGGGTTGGGAATTGGCGAATTGCCAAGGTAA
Gene >AgabiH97|017500
ATGGCGAAAAATGTCTTCTCGGTTCCCATCTTCATTATCGTCTTTCGAGAGACGTTGGAGGCTGCAATCATCATC
TCCGTCTTACTGAGCCTTGTCGAACAGCTTATAACAAGTAGAGTAGCCTCCTCCTCGGTGGTTCCGTCCAACGAG
GGCACGCGACATTCGGACGCTGATAGCAAGGATGCTGCTGACATCCGTTTGCCCACTACACTTGTCGAAGACGAC
TCGATCCAACGAAGAAGGGTTCTCAGACGAATGCGCATTCAGGTAAACCATCGTAATGACTATAATCTGTCAGTC
ACTATCACTTACGAGTTTATCAGATATTCCTTGGCGCGGGTCTGGGTCTGTTCCTTGCCATCGCCATCGGTGCTG
CGTAGGTCTTGACTATTAGCTACTGATAAAAATTTCTCATCTGGAATAAGGTTTATCGCCGTCTGGTTCACAAAG
GCAAGCGACCTCTGGGCAAAGGCCGAAGATCTTTGGGAAGGTGAACAATATGCTTACCTGCGTCGTCGCCGCTCC
TGAATTTTGTTGGTACAGGTATCTTCAACGTAATCGCCTCACTCATGATTTTCATCATGGGAGTCACCATGTTGA
AGATAGATAGTGGTCAGCATAATACCATACTTTCCGACGATGTTTAAAATACTGACGCGCATACAGCAAAAGTGA
AATGGAGAGTCAAGCTTGAGAAGGCCTTCGATGGATCCCGTGAGTGCGAGAATGAAGGCATAATAATTCCACCCA
CTAATGGAATTTGTTGTATCAGAAACGGATAAGAAAGCGAAGACCGGGAAATGGTTGCTCTTCGTGCTTCCCATG
GTGACACTATTGCGTGAAGGTATGTTAAAGCTGAATGGAGAATGTGATTCAAAACTCAACACTGTCTCTAGGCTT
AGAAGCTGTGGTTTTCGTGGGTGGTGTATCACTCGGCCAGCCGGCAACCTCAATACCTATTGCCGCTATCGTCGG
CATTGTCTGCGGCGTCGTCTTTGGATACCTCATCTATCAGTTCGCCAGCAGGACAGGTGAATTTAGTCTGCGCGT
TCTAATAGGATTACGGCTGAAGCGTTCGTTTCTAGCATTGACGGTCTTCCTTGTCGTAATGACAAACTTCCTCCT
ACTCGTTGGAGCGGGACTTTTCAGCAAAAGTATTGGAAACTTTGAACAGTACTCCTTCAACAAACTTCTAGGTGC
CGACGTCGACGATGCCGGAGGAACAGGCCCTGGTTCCTACCGTGTTCAGGGAAACGTCTGGCATATTGACTGCTG
TTCACCGGAAAATAACACAGACGGATGGACAATTTTCAACGCCATTTTCGGTTGGTCTAACAACGGCTCTCGTAC
GTGCTTTCCACTCGGTTTCCTTATTTGTGTTGATGTGTAACTGATTCGCATCTTGGTTAGTTGGAACTATACTTT
CATATGTGTTCTATTGGGTTGCCGTTATGGCCGTCCTGGTCTATATGAAATTCAAAGAGGTCAGTAATATTCTGT
ACAATCTGATATAGCCTTTGACGAAAATTTTATAGGGCCGCACGAAAATCTTCAATCACGAGTCTTCAATTTCAA
AAGTCAGAAGAGAGCGGAAGGAAGAAAAGGCTGCTCTCTACGACCTCGAAGCTAAGGAGAAGCAAGAAACACCCG
GGTTGGGAATTGGCGAATTGCCAAGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail