Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|017260
Gene name
Locationscaffold_10:611815..613453
Strand+
Gene length (bp)1638
Transcript length (bp)1521
Coding sequence length (bp)1521
Protein length (aa) 507

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00840 Glyco_hydro_7 Glycosyl hydrolase family 7 7.8E-204 21 450
PF00734 CBM_1 Fungal cellulose binding domain 1.6E-13 475 502

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38676|GUX1B_NEUCR Exoglucanase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cbh-1 PE=3 SV=1 4 505 0.0E+00
sp|A1DMA5|CBHA_NEOFI Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbhA PE=3 SV=1 1 451 0.0E+00
sp|Q9P8P3|GUX1_TRIHA Exoglucanase 1 OS=Trichoderma harzianum GN=cbh1 PE=1 SV=1 4 506 0.0E+00
sp|Q8WZJ4|XYNA_TALFU 1,4-beta-D-glucan cellobiohydrolase xynA OS=Talaromyces funiculosus GN=xynA PE=1 SV=1 4 506 0.0E+00
sp|P15828|GUX1_HUMGT Exoglucanase 1 OS=Humicola grisea var. thermoidea GN=CBH-1 PE=1 SV=2 27 506 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38676|GUX1B_NEUCR Exoglucanase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cbh-1 PE=3 SV=1 4 505 0.0E+00
sp|A1DMA5|CBHA_NEOFI Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbhA PE=3 SV=1 1 451 0.0E+00
sp|Q9P8P3|GUX1_TRIHA Exoglucanase 1 OS=Trichoderma harzianum GN=cbh1 PE=1 SV=1 4 506 0.0E+00
sp|Q8WZJ4|XYNA_TALFU 1,4-beta-D-glucan cellobiohydrolase xynA OS=Talaromyces funiculosus GN=xynA PE=1 SV=1 4 506 0.0E+00
sp|P15828|GUX1_HUMGT Exoglucanase 1 OS=Humicola grisea var. thermoidea GN=CBH-1 PE=1 SV=2 27 506 0.0E+00
sp|P46238|GUXC_FUSOX Putative exoglucanase type C OS=Fusarium oxysporum PE=2 SV=1 19 505 0.0E+00
sp|Q9UVS9|CBHA_ASPNG 1,4-beta-D-glucan cellobiohydrolase A OS=Aspergillus niger GN=cbhA PE=2 SV=1 1 451 0.0E+00
sp|Q7SA23|GUX1A_NEUCR Exoglucanase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cbh-1 PE=3 SV=1 19 505 0.0E+00
sp|A2QPG2|CBHA_ASPNC Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cbhA PE=3 SV=1 1 451 0.0E+00
sp|Q00328|GUX1_COCCA Exoglucanase 1 OS=Cochliobolus carbonum GN=CEL1 PE=3 SV=1 1 450 0.0E+00
sp|P19355|GUX1_HYPRU Exoglucanase 1 OS=Hypocrea rufa GN=cbh1 PE=3 SV=2 1 506 0.0E+00
sp|Q0CRF7|CBHA_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhA PE=3 SV=1 1 453 0.0E+00
sp|P62695|GUX1_TRIKO Exoglucanase 1 OS=Trichoderma koningii GN=cbh1 PE=3 SV=1 4 506 0.0E+00
sp|P62694|GUX1_HYPJE Exoglucanase 1 OS=Hypocrea jecorina GN=cbh1 PE=1 SV=1 4 506 0.0E+00
sp|Q06886|GUX1_PENJA Exoglucanase 1 OS=Penicillium janthinellum GN=cbh1 PE=2 SV=1 18 506 0.0E+00
sp|Q00548|GUX1_CRYPA Exoglucanase 1 OS=Cryphonectria parasitica GN=CBH-1 PE=3 SV=1 1 450 0.0E+00
sp|Q92400|GUX2_AGABI Exoglucanase OS=Agaricus bisporus GN=cel2 PE=2 SV=1 1 506 0.0E+00
sp|A1CU44|CBHB_ASPCL Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cbhB PE=3 SV=1 4 506 0.0E+00
sp|Q4WM08|CBHB_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhB PE=1 SV=1 1 506 0.0E+00
sp|B0Y8K2|CBHB_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhB PE=3 SV=1 1 506 0.0E+00
sp|Q8NK02|CBHB_EMENI 1,4-beta-D-glucan cellobiohydrolase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cbhB PE=3 SV=1 4 506 0.0E+00
sp|A1DNL0|CBHB_NEOFI Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbhB PE=3 SV=1 1 506 0.0E+00
sp|P13860|GUX1_PHACH Exoglucanase 1 OS=Phanerochaete chrysosporium GN=CBH1 PE=2 SV=1 1 506 0.0E+00
sp|Q0CMT2|CBHB_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhB PE=3 SV=1 19 506 0.0E+00
sp|Q9UVS8|CBHB_ASPNG 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus niger GN=cbhB PE=2 SV=1 4 506 0.0E+00
sp|A2QAI7|CBHB_ASPNC Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cbhB PE=3 SV=1 4 506 0.0E+00
sp|O59843|CBHB_ASPAC 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus aculeatus GN=cbhB PE=2 SV=1 8 506 0.0E+00
sp|A1CE97|CBHA_ASPCL Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cbhA PE=3 SV=1 1 452 0.0E+00
sp|Q4WNA2|CBHA_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhA PE=3 SV=1 1 450 0.0E+00
sp|B0Y793|CBHA_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhA PE=3 SV=1 1 450 0.0E+00
sp|Q5B2Q4|CBHA_EMENI Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cbhA PE=2 SV=1 1 450 0.0E+00
sp|Q2UBM3|CBHA_ASPOR Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cbhA PE=3 SV=1 1 451 0.0E+00
sp|B8N7G5|CBHA_ASPFN Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=cbhA PE=3 SV=1 1 451 0.0E+00
sp|A1D932|CELB_NEOFI Probable endo-beta-1,4-glucanase celB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=celB PE=3 SV=1 8 452 3.0E-117
sp|Q4WAJ6|CELB_ASPFU Probable endo-beta-1,4-glucanase celB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=celB PE=3 SV=1 7 451 1.0E-116
sp|B0YBX0|CELB_ASPFC Probable endo-beta-1,4-glucanase celB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=celB PE=3 SV=1 7 451 6.0E-116
sp|G2QCS4|CEL7A_MYCTT Endoglucanase 7a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=eg7A PE=1 SV=1 19 506 2.0E-113
sp|Q2TX26|CELB_ASPOR Endo-beta-1,4-glucanase celB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=celB PE=1 SV=1 10 452 5.0E-113
sp|B8NW70|CELB_ASPFN Probable endo-beta-1,4-glucanase celB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=celB PE=3 SV=1 10 452 5.0E-113
sp|A1CG87|CELB_ASPCL Probable endo-beta-1,4-glucanase celB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=celB PE=3 SV=1 19 450 1.0E-111
sp|Q0CC84|CELB_ASPTN Probable endo-beta-1,4-glucanase celB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=celB PE=3 SV=1 18 450 2.0E-106
sp|Q12714|GUN1_TRILO Endoglucanase EG-1 OS=Trichoderma longibrachiatum GN=egl1 PE=3 SV=1 5 506 1.0E-100
sp|P07981|GUN1_HYPJE Endoglucanase EG-1 OS=Hypocrea jecorina GN=egl1 PE=1 SV=1 10 506 4.0E-97
sp|Q5B7R2|CELB_EMENI Endo-beta-1,4-glucanase celB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=celB PE=1 SV=1 19 450 2.0E-94
sp|G4NK46|CEL7B_MAGO7 Endoglucanase 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=egl1 PE=1 SV=1 1 451 2.0E-88
sp|Q12622|GUN1_HUMGT Endoglucanase EG-1 OS=Humicola grisea var. thermoidea GN=EG-1 PE=3 SV=1 18 451 4.0E-86
sp|P56680|GUN1_HUMIN Endoglucanase 1 OS=Humicola insolens GN=CEL7B PE=1 SV=1 27 451 6.0E-85
sp|P46237|GUNC_FUSOX Endoglucanase type C OS=Fusarium oxysporum PE=1 SV=1 4 449 6.0E-77
sp|Q99034|AXE1_HYPJE Acetylxylan esterase OS=Hypocrea jecorina GN=axe1 PE=1 SV=1 462 506 6.0E-11
sp|P79046|XYN1_HUMGT Endo-1,4-beta-xylanase 1 OS=Humicola grisea var. thermoidea GN=xyn1 PE=2 SV=1 467 506 2.0E-09
sp|P43317|GUN5_HYPJE Endoglucanase-5 OS=Hypocrea jecorina GN=egl5 PE=3 SV=1 472 506 3.0E-08
sp|Q5ZNB1|XYND_TALFU Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus GN=xynD PE=1 SV=1 475 506 1.0E-07
sp|O14405|GUN4_HYPJE Endoglucanase-4 OS=Hypocrea jecorina GN=cel61a PE=1 SV=1 460 506 1.0E-07
sp|Q4WBW4|AXE1_ASPFU Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=axeA PE=3 SV=1 475 506 1.0E-07
sp|P49075|GUX3_AGABI Exoglucanase 3 OS=Agaricus bisporus GN=cel3 PE=1 SV=1 474 506 2.0E-07
sp|G2Q9T3|CEL61_MYCTT Polysaccharide monooxygenase Cel61a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=Cel61a PE=1 SV=1 467 506 3.0E-07
sp|Q4WFK4|CBHC_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhC PE=3 SV=1 472 506 3.0E-07
sp|B0XWL3|CBHC_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhC PE=3 SV=1 472 506 3.0E-07
sp|A1DJQ7|CBHC_NEOFI Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbhC PE=3 SV=1 472 506 7.0E-07
sp|I1S3C6|XYND_GIBZE Endo-1,4-beta-xylanase D OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=XYLD PE=1 SV=1 467 506 1.0E-06
sp|P07987|GUX2_HYPJE Exoglucanase 2 OS=Hypocrea jecorina GN=cbh2 PE=1 SV=1 473 506 2.0E-06
sp|A1DBP9|AXE1_NEOFI Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=axeA PE=3 SV=1 475 506 2.0E-06
sp|G4MM92|CEL6A_MAGO7 1,4-beta-D-glucan cellobiohydrolase CEL6A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=cel6A PE=1 SV=1 461 506 2.0E-06
sp|Q8J0K5|XYNB_TALFU Endo-1,4-beta-xylanase B OS=Talaromyces funiculosus GN=xynB PE=1 SV=1 475 505 2.0E-06
sp|A2QYR9|CBHC_ASPNC Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cbhC PE=3 SV=1 472 505 3.0E-06
sp|Q0CFP1|CBHC_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhC PE=3 SV=1 472 506 7.0E-06
sp|P07982|GUN2_HYPJE Endoglucanase EG-II OS=Hypocrea jecorina GN=egl2 PE=1 SV=1 472 506 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005576 extracellular region Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0030248 cellulose binding Yes
GO:0030246 carbohydrate binding No
GO:0044238 primary metabolic process No
GO:0110165 cellular anatomical entity No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0030247 polysaccharide binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|017260
MFPRSILLALSLTAVALGQQVGTNMAENHPSLTWQRCTSSGCQNVNGKVTLDANWRWTHRINDFTNCYTGNEWDT
SICPDGVTCAENCALDGADYAGTYGVTSSGTALTLKFVTESQQKNIGSRLYLMADDSNYEIFNLLNKEFTFDVDV
SKLPCGLNGALYFSEMAADGGMSSTNTAGAKYGTGYCDSQCPRDIKFIDGEANSEGWEGSPNDVNAGTGNFGACC
GEMDIWEANSISSAYTPHPCREPGLQRCEGNTCSVNDRYATECDPDGCDFNSFRMGDKSFYGPGMTVDTNQPITV
VTQFITDNGSDNGNLQEIRRIYVQNGQVIQNSNVNIPGIDSGNSISAEFCDQAKEAFGDERSFQDRGGLSGMGSA
LDRGMVLVLSIWDDHAVNMLWLDSDYPLDASPSQPGISRGTCSRDSGKPEDVEANAGGVQVVYSNIKFGDINSTF
NNNGGGGGNPSPTTTRPNSPAQTMWGQCGGQGWTGPTACQSPSTCHVINDFYSQCF*
Coding >AgabiH97|017260
ATGTTCCCGAGATCCATTCTCCTCGCCCTCTCCCTCACTGCTGTTGCCTTGGGCCAGCAAGTCGGTACCAACATG
GCCGAAAACCACCCATCGCTCACTTGGCAAAGGTGCACCAGTAGTGGTTGCCAGAACGTGAACGGCAAAGTCACC
CTCGACGCTAACTGGCGTTGGACTCACCGCATCAACGACTTCACCAACTGCTACACTGGTAACGAATGGGATACT
TCTATTTGTCCTGACGGCGTAACTTGTGCCGAGAACTGTGCGCTCGATGGTGCTGACTACGCAGGCACATACGGT
GTCACCTCCTCCGGTACCGCTCTTACTCTGAAATTCGTCACTGAGAGCCAGCAGAAGAACATTGGTTCTCGTCTC
TACCTCATGGCTGATGATTCCAACTATGAGATCTTCAACCTCTTGAACAAAGAGTTCACTTTCGACGTCGATGTC
TCCAAACTTCCTTGCGGTCTTAACGGTGCCCTTTACTTTTCGGAGATGGCTGCAGATGGTGGCATGTCGTCGACC
AATACGGCTGGTGCCAAGTACGGTACTGGTTATTGTGACTCGCAATGCCCTCGTGACATCAAGTTTATCGACGGA
GAGGCCAACAGCGAGGGTTGGGAAGGCTCCCCGAACGACGTCAACGCTGGAACCGGTAACTTTGGTGCCTGCTGC
GGTGAAATGGATATCTGGGAGGCCAACTCTATCTCTTCCGCCTACACTCCCCATCCTTGTAGGGAACCCGGACTC
CAGCGTTGCGAGGGTAACACTTGCTCAGTCAACGATCGCTATGCGACTGAGTGTGACCCCGACGGTTGTGATTTC
AACTCCTTCCGTATGGGAGACAAGTCGTTCTACGGCCCCGGCATGACAGTCGACACCAACCAGCCCATCACTGTC
GTCACTCAGTTTATCACTGATAATGGCTCCGACAACGGTAACCTCCAGGAGATCCGCCGCATCTACGTCCAGAAC
GGCCAGGTCATCCAGAACTCCAATGTCAACATTCCCGGAATCGACTCCGGCAACTCCATTTCCGCAGAATTCTGT
GATCAGGCTAAGGAAGCCTTCGGTGATGAGCGATCATTCCAAGATAGGGGTGGATTGTCGGGTATGGGTTCTGCG
TTGGACCGCGGAATGGTTCTCGTCCTTTCCATCTGGGATGACCATGCCGTTAACATGTTGTGGCTCGACTCTGAC
TACCCCCTTGACGCCTCCCCAAGTCAACCAGGTATCTCCCGTGGTACCTGCTCTAGGGACTCTGGTAAACCCGAG
GATGTTGAGGCTAACGCTGGCGGCGTCCAAGTCGTCTACTCCAATATCAAGTTCGGTGACATCAACTCCACTTTC
AACAACAACGGTGGTGGCGGTGGCAACCCCAGCCCAACTACCACTCGCCCCAACTCCCCCGCTCAAACCATGTGG
GGTCAATGTGGTGGTCAAGGCTGGACTGGCCCGACTGCTTGCCAATCTCCATCTACTTGCCACGTCATCAATGAC
TTCTATAGCCAATGTTTCTGA
Transcript >AgabiH97|017260
ATGTTCCCGAGATCCATTCTCCTCGCCCTCTCCCTCACTGCTGTTGCCTTGGGCCAGCAAGTCGGTACCAACATG
GCCGAAAACCACCCATCGCTCACTTGGCAAAGGTGCACCAGTAGTGGTTGCCAGAACGTGAACGGCAAAGTCACC
CTCGACGCTAACTGGCGTTGGACTCACCGCATCAACGACTTCACCAACTGCTACACTGGTAACGAATGGGATACT
TCTATTTGTCCTGACGGCGTAACTTGTGCCGAGAACTGTGCGCTCGATGGTGCTGACTACGCAGGCACATACGGT
GTCACCTCCTCCGGTACCGCTCTTACTCTGAAATTCGTCACTGAGAGCCAGCAGAAGAACATTGGTTCTCGTCTC
TACCTCATGGCTGATGATTCCAACTATGAGATCTTCAACCTCTTGAACAAAGAGTTCACTTTCGACGTCGATGTC
TCCAAACTTCCTTGCGGTCTTAACGGTGCCCTTTACTTTTCGGAGATGGCTGCAGATGGTGGCATGTCGTCGACC
AATACGGCTGGTGCCAAGTACGGTACTGGTTATTGTGACTCGCAATGCCCTCGTGACATCAAGTTTATCGACGGA
GAGGCCAACAGCGAGGGTTGGGAAGGCTCCCCGAACGACGTCAACGCTGGAACCGGTAACTTTGGTGCCTGCTGC
GGTGAAATGGATATCTGGGAGGCCAACTCTATCTCTTCCGCCTACACTCCCCATCCTTGTAGGGAACCCGGACTC
CAGCGTTGCGAGGGTAACACTTGCTCAGTCAACGATCGCTATGCGACTGAGTGTGACCCCGACGGTTGTGATTTC
AACTCCTTCCGTATGGGAGACAAGTCGTTCTACGGCCCCGGCATGACAGTCGACACCAACCAGCCCATCACTGTC
GTCACTCAGTTTATCACTGATAATGGCTCCGACAACGGTAACCTCCAGGAGATCCGCCGCATCTACGTCCAGAAC
GGCCAGGTCATCCAGAACTCCAATGTCAACATTCCCGGAATCGACTCCGGCAACTCCATTTCCGCAGAATTCTGT
GATCAGGCTAAGGAAGCCTTCGGTGATGAGCGATCATTCCAAGATAGGGGTGGATTGTCGGGTATGGGTTCTGCG
TTGGACCGCGGAATGGTTCTCGTCCTTTCCATCTGGGATGACCATGCCGTTAACATGTTGTGGCTCGACTCTGAC
TACCCCCTTGACGCCTCCCCAAGTCAACCAGGTATCTCCCGTGGTACCTGCTCTAGGGACTCTGGTAAACCCGAG
GATGTTGAGGCTAACGCTGGCGGCGTCCAAGTCGTCTACTCCAATATCAAGTTCGGTGACATCAACTCCACTTTC
AACAACAACGGTGGTGGCGGTGGCAACCCCAGCCCAACTACCACTCGCCCCAACTCCCCCGCTCAAACCATGTGG
GGTCAATGTGGTGGTCAAGGCTGGACTGGCCCGACTGCTTGCCAATCTCCATCTACTTGCCACGTCATCAATGAC
TTCTATAGCCAATGTTTCTGA
Gene >AgabiH97|017260
ATGTTCCCGAGATCCATTCTCCTCGCCCTCTCCCTCACTGCTGTTGCCTTGGGCCAGCAAGTCGGTACCAACATG
GCCGAAAACCACCCATCGCTCACTTGGCAAAGGTGCACCAGTAGTGGTTGCCAGAACGTGAACGGCAAAGTCACC
CTCGACGCTAACTGGCGTTGGACTCACCGCATCAACGACTTCACCAACTGCTACACTGGTAACGAATGGGATACT
TCTATTTGTCCTGACGGCGTAACTTGTGCCGAGAACTGTGCGCTCGATGGTGCTGACTACGCAGGCACATACGGT
GTCACCTCCTCCGGTACCGCTCTTACTCTGAAATTCGTCACTGAGAGCCAGCAGAAGAACATTGGTTCTCGTCTC
TACCTCATGGCTGATGATTCCAACTATGAGATCTTCAACCTCTTGAACAAAGAGTTCACTTTCGACGTCGATGTC
TCCAAACTTCCTTGCGGTCTTAACGGTGCCCTTTACTTTTCGGAGATGGCTGCAGATGGTGGCATGTCGTCGACC
AATACGGCTGGTGCCAAGTACGGTACTGGTTATTGTGACTCGCAATGCCCTCGTGACATCAAGTTTATCGACGGA
GAGGTAAGCAATGAAATATTCTCGCTATAAGTAGCTCAGCTAACAATAAATTGATTAGGCCAACAGCGAGGGTTG
GGAAGGCTCCCCGAACGACGTCAACGCTGGAACCGGTAACTTTGGTGCCTGCTGCGGTGAAATGGATATCTGGGA
GGCCAACTCTATCTCTTCCGCCTACACTCCCCATCCTTGTAGGGAACCCGGACTCCAGCGTTGCGAGGGTAACAC
TTGCTCAGTCAACGATCGCTATGCGACTGAGTGTGACCCCGACGGTTGTGATTTCAACTCCTTCCGTATGGGAGA
CAAGTCGTTCTACGGCCCCGGCATGACAGTCGACACCAACCAGCCCATCACTGTCGTCACTCAGTTTATCACTGA
TAATGGCTCCGACAACGGTAACCTCCAGGAGATCCGCCGCATCTACGTCCAGAACGGCCAGGTCATCCAGAACTC
CAATGTCAACATTCCCGGAATCGACTCCGGCAACTCCATTTCCGCAGAATTCTGTGATCAGGCTAAGGAAGCCTT
CGGTGATGAGCGATCATTCCAAGATAGGGGTGGATTGTCGGGTATGGGTTCTGCGTTGGACCGCGGAATGGTTCT
CGTCCTTTCCATCTGGGATGACCATGCCGTTAACATGTTGTGGCTCGACTCTGACTACCCCCTTGACGCCTCCCC
AAGTCAACCAGGTATCTCCCGTGGTACCTGCTCTAGGGACTCTGGTAAACCCGAGGATGTTGAGGCTAACGCTGG
CGGCGTCCAAGTCGTCTACTCCAATATCAAGTTCGGTGACATCAACTCCACTTTCAACAACAACGGTGGTGGCGG
TGGCAACCCCAGCCCAACTACCACTCGCCCCAACTCCCCCGCTCAAACCATGTGGGGTCAATGGTGAGTTTTGGC
TTTAGACTTCTGTAATCAAATTTCGAGAGCTGACTTGTAATCTTTTCTAGTGGTGGTCAAGGCTGGACTGGCCCG
ACTGCTTGCCAATCTCCATCTACTTGCCACGTCATCAATGACTTCTATAGCCAATGTTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail