Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|017250
Gene name
Locationscaffold_10:606679..610479
Strand+
Gene length (bp)3800
Transcript length (bp)2826
Coding sequence length (bp)2826
Protein length (aa) 942

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19501 YetA YetA-like protein 1.6E-302 6 891

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O31530|YETA_BACSU Uncharacterized protein YetA OS=Bacillus subtilis (strain 168) GN=yetA PE=4 SV=2 7 893 6.0E-144

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|017250
MTSPSARVHWLDGSSPAFTPSGTAFGIPWSQGEIDRTTPLKIRSSSTSLPLQSWPLAYWPDGTLKWSGHALPANL
ATDSSELIVSPGTPTEPESPVSVTHDGDATIVSTGPFSVRFNAPGSTSLISSIVLNGKTLARNASLVLHVQNAPD
PDLTLVQTGITQFPDIQSMNGKIDTVQVEQEGPVRAVIKMTGKYTATTGGEHADFLPFTLRFYISSGATTLRMVH
FFIYDGDQTKDFIKGLGLTFSTPMSDQLHDRHIRFLSSPFPNASASKPDASDSGVAGVWGEAARVVSGLRRDATA
PVLDAQFNGTPTPPLNTWPSTVTAGLDDLPAWSDYSLDQLSPSYFSISKRTNASTKANWVDHAGHGTRAAGLGYV
GGATNGGVVFGLRDFWQGAPRSLHVRNAAEDVANVTLWAWSPQAPAMDMRHYDTVPHGLDLTYEDVGNPDPTPIG
IGRSYEITLQLFSATPSRSDLAKLADVHTRVPQLVSTPKFYASKKLFGGRWDLPDTTRSGAAIIEKQKSDLLDFY
IKDIDQRQFYGFWNYGDVMHTYDQTRHEWRYDIGGFAWDNGELGTDLWLWLSFLRTGRADVFRIASALTRHLSET
DTHHTGPLAGLGSRHNVSHWGDGAKEARVSGSWLRRPFYFITTDELMGDMMDLTLQADQTIMEWDPLRKVLPPPP
PEGPGRLRIGPDWTALAGNWFTKWERTMDNQWLERMKVGMRDIGSFKFGLFTGDGSAVGWNADTAHLVDEGGEGK
SSYHLMMLFGGGEFLMEAMDLPVIRDDVPEFDAAWLDFCRLFNGTNDEKIARYGKAFSSGGFQQLYAKLQAYVGQ
RLNQTELQERAWDFLNGNTTGVYPPAVSVGGTDALNPIMEIVNLATNDAAHLSLSQYAVLAIAPDLAPNEVWDSQ
EGDEATIVNFDKNLLKLPGDSDLPKQRQRSSGKWKKLLCMS*
Coding >AgabiH97|017250
ATGACTTCACCAAGTGCTCGCGTGCATTGGCTTGATGGATCCTCTCCAGCTTTTACCCCTTCTGGGACGGCCTTT
GGTATTCCCTGGTCTCAAGGGGAAATTGATCGCACAACGCCATTGAAGATTCGATCGTCTTCTACAAGTCTCCCT
TTGCAGAGTTGGCCACTCGCATACTGGCCGGATGGTACTCTGAAATGGTCTGGGCATGCGCTTCCGGCGAATCTG
GCCACCGACTCGTCAGAGCTAATCGTGTCACCTGGGACTCCGACTGAGCCTGAATCGCCCGTCTCGGTAACACAT
GATGGCGATGCTACGATAGTCTCAACAGGACCTTTCTCAGTTCGGTTTAATGCGCCTGGTTCAACGAGTTTAATA
TCTTCGATCGTTTTGAATGGTAAAACTCTCGCTCGAAATGCATCTCTCGTCCTTCATGTCCAGAATGCCCCGGAT
CCTGATCTAACACTCGTTCAAACTGGTATCACACAATTTCCTGATATTCAGAGTATGAATGGTAAGATCGATACT
GTTCAAGTTGAACAAGAAGGCCCCGTCCGCGCTGTAATCAAAATGACGGGTAAATACACAGCGACAACGGGTGGT
GAACATGCCGATTTTCTTCCGTTCACTCTACGCTTTTATATCTCTTCTGGGGCTACAACGCTCCGAATGGTTCAC
TTTTTCATATACGATGGTGACCAGACCAAAGATTTCATCAAGGGCCTTGGCCTGACTTTTTCGACACCAATGTCG
GACCAACTCCATGACAGACACATTCGGTTCCTGTCCTCCCCATTTCCCAATGCATCTGCATCCAAGCCAGACGCG
TCTGATTCTGGAGTAGCCGGTGTTTGGGGTGAAGCGGCACGTGTTGTTTCCGGACTTCGTCGGGACGCCACCGCT
CCGGTTCTTGATGCTCAATTCAATGGGACACCTACTCCACCTCTCAATACGTGGCCATCGACTGTGACTGCCGGG
CTTGATGACTTGCCGGCATGGTCAGACTATTCGCTTGACCAACTGTCTCCGTCATATTTCTCCATCAGTAAACGT
ACAAACGCAAGTACCAAGGCGAACTGGGTTGATCATGCTGGTCATGGAACGCGAGCAGCAGGATTGGGATATGTA
GGAGGCGCTACAAATGGAGGGGTAGTTTTCGGATTACGAGATTTCTGGCAAGGTGCCCCTAGGAGTTTACATGTT
AGAAATGCGGCGGAGGATGTAGCAAATGTGACACTTTGGGCGTGGAGCCCTCAGGCTCCAGCCATGGATATGCGA
CATTATGATACAGTTCCTCATGGACTTGACCTCACATACGAGGACGTGGGTAATCCGGACCCCACTCCTATTGGA
ATCGGAAGGTCATACGAAATAACTTTGCAACTCTTCTCAGCCACACCAAGCCGATCCGATTTAGCAAAACTAGCG
GATGTACATACCCGCGTCCCTCAGCTTGTTTCCACGCCTAAGTTCTATGCGTCGAAGAAATTGTTTGGTGGTCGA
TGGGATTTACCTGATACAACGCGAAGTGGCGCTGCGATAATTGAGAAACAGAAAAGCGATCTTTTGGATTTCTAC
ATCAAGGATATTGACCAGAGACAGTTCTACGGATTCTGGAACTATGGTGATGTCATGCATACTTACGATCAAACG
AGGCATGAATGGCGATATGATATTGGCGGATTTGCTTGGGACAATGGTGAACTCGGAACCGATCTGTGGCTTTGG
CTCTCCTTCCTCCGTACAGGCCGTGCAGACGTCTTCCGCATCGCATCGGCTTTGACACGCCATCTTTCTGAGACG
GATACGCATCACACCGGTCCGTTAGCTGGACTTGGCTCAAGGCACAACGTTAGTCATTGGGGAGATGGCGCCAAA
GAGGCACGAGTTTCTGGAAGCTGGTTGAGAAGACCATTTTATTTTATCACGACGGACGAGCTCATGGGAGATATG
ATGGATTTGACGCTTCAAGCCGACCAGACGATCATGGAATGGGATCCACTACGAAAGGTTTTACCACCTCCACCC
CCTGAGGGGCCTGGTCGACTCAGGATTGGACCTGACTGGACTGCTTTAGCCGGTAATTGGTTTACCAAGTGGGAG
AGAACTATGGACAACCAGTGGCTTGAGAGGATGAAGGTCGGCATGAGAGATATAGGAAGCTTCAAGTTCGGACTA
TTCACGGGAGATGGATCAGCTGTGGGATGGAACGCTGATACAGCACACTTGGTAGATGAAGGCGGGGAAGGCAAA
AGCTCGTATCACCTCATGATGCTTTTTGGAGGCGGTGAATTCCTGATGGAAGCCATGGATCTGCCCGTTATTCGC
GATGATGTACCGGAGTTCGATGCTGCCTGGTTGGATTTCTGCCGTCTCTTTAATGGTACGAACGATGAGAAAATT
GCGAGGTATGGGAAAGCATTTTCAAGTGGAGGCTTTCAGCAGCTCTATGCTAAGCTGCAAGCTTATGTGGGTCAA
CGCTTGAATCAGACTGAGCTCCAAGAACGGGCTTGGGACTTTTTGAATGGGAATACCACCGGTGTATATCCACCT
GCTGTCTCGGTCGGCGGAACAGATGCGTTGAACCCAATCATGGAGATTGTGAATTTGGCTACCAACGATGCTGCC
CATCTCTCCCTTTCTCAATATGCGGTTCTTGCAATTGCGCCAGACTTAGCTCCAAATGAGGTGTGGGATTCACAA
GAAGGGGACGAGGCGACCATAGTCAATTTTGATAAAAATCTTCTCAAGCTTCCTGGGGACTCGGACTTACCGAAA
CAGAGACAGAGGTCGAGTGGGAAATGGAAGAAGCTCCTCTGCATGTCCTGA
Transcript >AgabiH97|017250
ATGACTTCACCAAGTGCTCGCGTGCATTGGCTTGATGGATCCTCTCCAGCTTTTACCCCTTCTGGGACGGCCTTT
GGTATTCCCTGGTCTCAAGGGGAAATTGATCGCACAACGCCATTGAAGATTCGATCGTCTTCTACAAGTCTCCCT
TTGCAGAGTTGGCCACTCGCATACTGGCCGGATGGTACTCTGAAATGGTCTGGGCATGCGCTTCCGGCGAATCTG
GCCACCGACTCGTCAGAGCTAATCGTGTCACCTGGGACTCCGACTGAGCCTGAATCGCCCGTCTCGGTAACACAT
GATGGCGATGCTACGATAGTCTCAACAGGACCTTTCTCAGTTCGGTTTAATGCGCCTGGTTCAACGAGTTTAATA
TCTTCGATCGTTTTGAATGGTAAAACTCTCGCTCGAAATGCATCTCTCGTCCTTCATGTCCAGAATGCCCCGGAT
CCTGATCTAACACTCGTTCAAACTGGTATCACACAATTTCCTGATATTCAGAGTATGAATGGTAAGATCGATACT
GTTCAAGTTGAACAAGAAGGCCCCGTCCGCGCTGTAATCAAAATGACGGGTAAATACACAGCGACAACGGGTGGT
GAACATGCCGATTTTCTTCCGTTCACTCTACGCTTTTATATCTCTTCTGGGGCTACAACGCTCCGAATGGTTCAC
TTTTTCATATACGATGGTGACCAGACCAAAGATTTCATCAAGGGCCTTGGCCTGACTTTTTCGACACCAATGTCG
GACCAACTCCATGACAGACACATTCGGTTCCTGTCCTCCCCATTTCCCAATGCATCTGCATCCAAGCCAGACGCG
TCTGATTCTGGAGTAGCCGGTGTTTGGGGTGAAGCGGCACGTGTTGTTTCCGGACTTCGTCGGGACGCCACCGCT
CCGGTTCTTGATGCTCAATTCAATGGGACACCTACTCCACCTCTCAATACGTGGCCATCGACTGTGACTGCCGGG
CTTGATGACTTGCCGGCATGGTCAGACTATTCGCTTGACCAACTGTCTCCGTCATATTTCTCCATCAGTAAACGT
ACAAACGCAAGTACCAAGGCGAACTGGGTTGATCATGCTGGTCATGGAACGCGAGCAGCAGGATTGGGATATGTA
GGAGGCGCTACAAATGGAGGGGTAGTTTTCGGATTACGAGATTTCTGGCAAGGTGCCCCTAGGAGTTTACATGTT
AGAAATGCGGCGGAGGATGTAGCAAATGTGACACTTTGGGCGTGGAGCCCTCAGGCTCCAGCCATGGATATGCGA
CATTATGATACAGTTCCTCATGGACTTGACCTCACATACGAGGACGTGGGTAATCCGGACCCCACTCCTATTGGA
ATCGGAAGGTCATACGAAATAACTTTGCAACTCTTCTCAGCCACACCAAGCCGATCCGATTTAGCAAAACTAGCG
GATGTACATACCCGCGTCCCTCAGCTTGTTTCCACGCCTAAGTTCTATGCGTCGAAGAAATTGTTTGGTGGTCGA
TGGGATTTACCTGATACAACGCGAAGTGGCGCTGCGATAATTGAGAAACAGAAAAGCGATCTTTTGGATTTCTAC
ATCAAGGATATTGACCAGAGACAGTTCTACGGATTCTGGAACTATGGTGATGTCATGCATACTTACGATCAAACG
AGGCATGAATGGCGATATGATATTGGCGGATTTGCTTGGGACAATGGTGAACTCGGAACCGATCTGTGGCTTTGG
CTCTCCTTCCTCCGTACAGGCCGTGCAGACGTCTTCCGCATCGCATCGGCTTTGACACGCCATCTTTCTGAGACG
GATACGCATCACACCGGTCCGTTAGCTGGACTTGGCTCAAGGCACAACGTTAGTCATTGGGGAGATGGCGCCAAA
GAGGCACGAGTTTCTGGAAGCTGGTTGAGAAGACCATTTTATTTTATCACGACGGACGAGCTCATGGGAGATATG
ATGGATTTGACGCTTCAAGCCGACCAGACGATCATGGAATGGGATCCACTACGAAAGGTTTTACCACCTCCACCC
CCTGAGGGGCCTGGTCGACTCAGGATTGGACCTGACTGGACTGCTTTAGCCGGTAATTGGTTTACCAAGTGGGAG
AGAACTATGGACAACCAGTGGCTTGAGAGGATGAAGGTCGGCATGAGAGATATAGGAAGCTTCAAGTTCGGACTA
TTCACGGGAGATGGATCAGCTGTGGGATGGAACGCTGATACAGCACACTTGGTAGATGAAGGCGGGGAAGGCAAA
AGCTCGTATCACCTCATGATGCTTTTTGGAGGCGGTGAATTCCTGATGGAAGCCATGGATCTGCCCGTTATTCGC
GATGATGTACCGGAGTTCGATGCTGCCTGGTTGGATTTCTGCCGTCTCTTTAATGGTACGAACGATGAGAAAATT
GCGAGGTATGGGAAAGCATTTTCAAGTGGAGGCTTTCAGCAGCTCTATGCTAAGCTGCAAGCTTATGTGGGTCAA
CGCTTGAATCAGACTGAGCTCCAAGAACGGGCTTGGGACTTTTTGAATGGGAATACCACCGGTGTATATCCACCT
GCTGTCTCGGTCGGCGGAACAGATGCGTTGAACCCAATCATGGAGATTGTGAATTTGGCTACCAACGATGCTGCC
CATCTCTCCCTTTCTCAATATGCGGTTCTTGCAATTGCGCCAGACTTAGCTCCAAATGAGGTGTGGGATTCACAA
GAAGGGGACGAGGCGACCATAGTCAATTTTGATAAAAATCTTCTCAAGCTTCCTGGGGACTCGGACTTACCGAAA
CAGAGACAGAGGTCGAGTGGGAAATGGAAGAAGCTCCTCTGCATGTCCTGA
Gene >AgabiH97|017250
ATGACTTCACCAAGTGCTCGCGTGCATTGGCTTGATGGATCCTCTCCAGCTTTTACCCCTTCTGGGACGGCCTTT
GGTATTCCCTGGTCTCAAGGGGAAATTGATCGCACAACGCCATTGAAGATTCGATCGTCTTCTACAAGTCTCCCT
TTGCAGAGTTGGCCACTCGCATAGTAAGTACCCCCCTTAAACTCTCATGTTTGCTGAATCTAAGGTGTATCTCAT
CCAGCTGGCCGGATGGTACTCTGAAATGGTCTGGGCATGCGCTTCCGGCGAATCTGGCCACCGACTCGTCAGAGC
TAATCGTGTCACCTGGGACTCCGACTGAGCCTGAATCGCCCGTCTCGGTAACACATGATGGCGATGCTACGATAG
TCTCAACAGGACCTTTCTCAGGTGATCATCTTACTTCATGTTCTTTGTTCATTAGTGGAGAATTGATTTTGATTC
TGATAGTTCGGTTTAATGCGCCTGGTTCAACGAGTTTAATATCTTCGATCGTTTTGAATGGTAAAACTCTCGCTC
GAAATGCATCTCTCGTCCTTCATGTCCAGAATGCCCCGGATCCTGATCTAACACTCGTTCAAACTGGTATCACAC
AATTTCCTGATATTCAGAGTATGAATGGTAAGATCGATACTGTTCAAGTTGAACAAGAAGGCCCCGTCCGCGCTG
TAATCAAAGTGTGTCGACACTCACAAACTGCTACTATAGATTTATCTGACGAAGTAATAACAGATGACGGGTAAA
TACACAGCGACAACGGGTGGTGAACATGCCGATTTTCTTCCGTTCACTCTACGCTTTTATATCTCTTCTGGGGCT
ACAACGCTCCGAATGGTTCACTTTTTCATATACGATGGTGACCAGACCAAAGATTTCATCAAGGGCCTTGGCCTG
ACTTTTTCGACACCAATGTCGGACCAACTCCATGACAGACACATTCGGTTCCTGTCCTCCCCATTTCCCAATGCA
TCTGCATCCAAGCCAGACGCGTCTGATTCTGGAGTAGCCGGTGCGTAAGATCGTTATGGGCTCGATACAATCTTT
GAGATATAATTGAGATTTAAACTTTTAAGGTGTTTGGGGTGAAGCGGCACGTGTTGTTTCCGGACTTCGTCGGGA
CGCCACCGCTCCGGTTCTTGATGCTCAATTCAATGGGACACCTACTCCACCTCTCAATACGTGGCCATCGACTGT
GACTGCCGGGCTTGATGACTTGCCGGTATGAGGAGAGTATTCTCCTTGCTGGCTCTTGAGCTTATTACCATTGCT
AGGCATGGTCAGACTATTCGCTTGACCAACTGTCTCCGTCATATTTCTCCATCAGTAAACGTACAAACGCAAGTA
CCAAGGCGAACTGGGTTGATCATGCTGGTCATGGAACGCGAGCAGCAGGATTGGGATATGTAGGAGGCGCTACAA
ATGGAGGGGTAGTTTTCGGATTACGAGGTGAGAGAGAGCGCGCACTTGTCTTCTTAGACTGACTCCGATGGCGCA
TGCCAGATTTCTGGCAAGGTGCCCCTAGGAGTTTACATGTTAGAAATGCGGCGGAGGATGTAGCAAATGTGACAC
TTTGGGCGTGGAGCCCTCAGGTACGTGTGGTTCACTATTTCCGTTGATATCCTTCCTCAGGATTGCGCAGGCTCC
AGCCATGGATATGCGACATTATGATACAGTTCCTCATGGAGTGAGCTACATCTCTCCAGGAATATTTCACTTTGT
AAATGTGGCTTTAGCTTGACCTCACATACGAGGACGTGGGTAATCCGGACCCCACTCCTATTGGAATCGGAAGGT
CATACGAAATAACTTTGCAACTCTTCTCAGCCACACCAAGCCGATCCGATTTAGCAAAACTAGCGGATGTACATG
TATGTTTCGCGCATTTTATGGTCTGAAGTTTTACTGACTTTTATAGACCCGCGTCCCTCAGCTTGTTTCCACGCC
TAAGTTCTATGCGTCGAAGAAATTGTTTGGTGGTCGATGGGATTTACCTGATACAACGCGAAGTGGCGCTGCGAT
AATTGAGAAACAGAAAAGCGATCTTTTGGATTTCTACATCAAGGTTAGAATATACATTTCGCGTTTATGAAAAGC
AATTAAAACGTCCTTTGGCAGGATATTGACCAGAGACAGTTCTACGGATTCTGGAACTATGGTGATGTCATGCAT
ACTTACGATCAAACGAGGCATGAATGGCGATATGATATTGGCGGATTTGCTTGGGACAATGGTGAACTCGGTAAG
TGTACCATTCTCTCGACTATCGCATATATTGACTCAGTCGTTCCTCAAGGAACCGATCTGTGGCTTTGGCTCTCC
TTCCTCCGTACAGGCCGTGCAGACGTCTTCCGCATCGCATCGGCTTTGACACGCCATCTTTCTGAGACGGATACG
CATCACACCGGTCCGTTAGCTGGACTTGGCTCAAGGCACAACGTTAGTCATTGGGGAGATGGCGCCAAAGAGGCA
CGAGTTTCTGGAAGCTGGTTGAGAAGACCATTTTATTTTATCACGAGTACGTTACCAGAAAATTGTTCAAGATAA
GAGGCTGAGTAGAAACGTTAGCGGACGAGCTCATGGGAGATATGATGGATTTGACGCTTCAAGCCGACCAGACGA
TCATGGAATGGGATCCACTACGAAAGGTTTTACCACCTCCACCCCCTGAGGGGCCTGGTCGACTCAGGATTGGAC
CTGACTGGACTGCTTTAGCCGGTAATTGGTTTACCAAGTGGGAGAGAACTGTAAGTATTTCGTGACTGTTTACAT
CTCTGCGTTGACTCAAGCATGCCGAAGATGGACAACCAGTGGCTTGAGAGGATGAAGGTCGGCATGGTGAGGTTC
TATAAATGCGACGATTTTTCCATCGCTTAATTTGGTCGCAGAGAGATATAGGAAGCTTCAAGTTCGGACTATTCA
CGGGAGATGGATCAGCTGTGGGATGGAACGCTGATACAGCACACTTGGTAGATGAAGGCGGGGAAGGCAAAAGCT
CGTAAGTTCTAACTGAACAAGTCATCACCATTGTAACTTGAATCAACGAAACTCAAGGTATCACCTCATGATGCT
TTTTGGAGGCGGTGAATTCCTGATGGAAGCCATGGATCTGCCCGTTATTCGCGATGATGTACCGGAGTTCGATGC
TGCCTGGTTGGATTTCTGCCGTCTCTTTAATGGTACGAACGATGAGTAAGCACCGGCGAATTTTTCGGATCAGTG
TATAAGAGCTAATGTTCGGATTTACAGGAAAATTGCGAGGTATGGGAAAGCATTTTCAAGTGGAGGCTTTCAGCA
GGTGCTGTGCTGTTTTTATTCGCGTGCACGCTAGTTTCTCAGACATTTTTCTATAGCTCTATGCTAAGCTGCAAG
CTTATGTGGGTCAACGCTTGAATCAGACTGAGCTCCAAGAACGGGCTTGGGACTTTTTGAATGGGAATACCACCG
GTGTATATCCACCTGCTGTCTCGGTCGGCGGAACAGATGCGTTGAACCCAATCATGGAGGTAAGAAATCCTCGCA
TGAATGGTATACCTGGCTGACTGCGAGGTGTTTCCGAAATTAAGATTGTGAATTTGGCTACCAACGATGCTGCCC
ATCTCTCCCTTTCTCAATATGCGGTTCTTGCAATTGCGCCAGACTTAGCTCCAAATGAGGTGTGGGATTCACAAG
AAGGGGACGAGGCGACCATAGTCAATTTTGATAAAAATCTTCTCAAGCTTCCTGGGGACTCGGACTTACCGAAAC
AGAGACAGAGGTCGAGTGGGAAATGGAAGAAGCTCCTCTGCATGTCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail