Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|017240
Gene name
Locationscaffold_10:605031..606100
Strand-
Gene length (bp)1069
Transcript length (bp)903
Coding sequence length (bp)903
Protein length (aa) 301

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09451 ATG27 Autophagy-related protein 27 9.4E-20 19 244

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 227 249 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|017240
MAVGCSLDFSYSFSNTSHLLSYDLCPLFSQHPSLRHEISEDTLPTRTNYVYEIALGKGIQKDGTLPEDLQCPHDS
LVCMRAINTRPNHPSEPPRILQVIPVATRHTKPKFRIAKTTTGTDIQEPHLQLTVQGSEYMGMKQKAVFHIYCDE
KLHEASTSGQLDHLYQWKGSHVFSWRSEHGCPKITTHDSKDDSDKTPDSHEEEENETTPPANVHEDEDSIIKTPS
QTLIWFISLTASILLAIAFRFVFLKRYKHHILQLIHKLPISRRRHRSGEYDFLLEDIASEESTVYSPGFRKYDAV
*
Coding >AgabiH97|017240
ATGGCTGTGGGATGTTCTCTCGACTTCAGCTACTCATTTTCCAACACATCTCATCTTCTTTCCTATGACTTGTGC
CCACTGTTTTCGCAGCATCCATCGTTGAGACACGAAATCAGTGAAGATACGCTACCGACGCGCACAAATTATGTT
TATGAAATAGCTTTGGGGAAGGGTATCCAGAAGGATGGTACCTTACCTGAGGACTTGCAGTGCCCCCATGATTCG
CTAGTATGTATGCGAGCCATTAACACTCGACCAAATCATCCTTCGGAGCCGCCAAGAATTCTTCAGGTCATCCCT
GTCGCAACCCGTCACACCAAACCAAAGTTTCGTATCGCAAAGACAACTACGGGAACAGATATACAAGAGCCTCAT
CTCCAACTCACCGTTCAAGGATCAGAATATATGGGTATGAAGCAAAAAGCTGTATTTCACATTTACTGTGATGAG
AAATTACATGAAGCGTCAACTTCAGGGCAGCTCGATCATTTGTACCAATGGAAGGGATCTCATGTTTTCAGCTGG
AGATCTGAACATGGTTGCCCAAAAATCACTACTCACGACAGCAAGGACGACTCCGACAAGACGCCAGACAGCCAT
GAAGAAGAGGAGAACGAAACCACCCCGCCGGCCAATGTGCATGAAGATGAAGACTCAATCATAAAAACACCATCA
CAAACACTCATATGGTTTATCTCATTAACGGCTAGCATTCTTCTCGCCATCGCATTCCGATTTGTCTTTCTCAAA
CGATACAAGCATCATATCCTTCAATTGATCCACAAACTCCCTATATCTAGACGTCGTCATCGATCCGGTGAATAC
GACTTTCTACTAGAAGATATCGCATCGGAGGAATCCACCGTTTATTCGCCCGGATTTAGAAAATACGACGCAGTA
TGA
Transcript >AgabiH97|017240
ATGGCTGTGGGATGTTCTCTCGACTTCAGCTACTCATTTTCCAACACATCTCATCTTCTTTCCTATGACTTGTGC
CCACTGTTTTCGCAGCATCCATCGTTGAGACACGAAATCAGTGAAGATACGCTACCGACGCGCACAAATTATGTT
TATGAAATAGCTTTGGGGAAGGGTATCCAGAAGGATGGTACCTTACCTGAGGACTTGCAGTGCCCCCATGATTCG
CTAGTATGTATGCGAGCCATTAACACTCGACCAAATCATCCTTCGGAGCCGCCAAGAATTCTTCAGGTCATCCCT
GTCGCAACCCGTCACACCAAACCAAAGTTTCGTATCGCAAAGACAACTACGGGAACAGATATACAAGAGCCTCAT
CTCCAACTCACCGTTCAAGGATCAGAATATATGGGTATGAAGCAAAAAGCTGTATTTCACATTTACTGTGATGAG
AAATTACATGAAGCGTCAACTTCAGGGCAGCTCGATCATTTGTACCAATGGAAGGGATCTCATGTTTTCAGCTGG
AGATCTGAACATGGTTGCCCAAAAATCACTACTCACGACAGCAAGGACGACTCCGACAAGACGCCAGACAGCCAT
GAAGAAGAGGAGAACGAAACCACCCCGCCGGCCAATGTGCATGAAGATGAAGACTCAATCATAAAAACACCATCA
CAAACACTCATATGGTTTATCTCATTAACGGCTAGCATTCTTCTCGCCATCGCATTCCGATTTGTCTTTCTCAAA
CGATACAAGCATCATATCCTTCAATTGATCCACAAACTCCCTATATCTAGACGTCGTCATCGATCCGGTGAATAC
GACTTTCTACTAGAAGATATCGCATCGGAGGAATCCACCGTTTATTCGCCCGGATTTAGAAAATACGACGCAGTA
TGA
Gene >AgabiH97|017240
ATGGCTGTGGGATGTTCTCTCGACTTCAGCTACTCATTTTCCAACACATCTCATCTTCTTTCCTATGACTTGTGC
CCACTGTTTTCGCAGCATCCATCGTTGAGACACGAAATCAGTGAAGATACGCTACCGACGCGCACAAATTATGTT
TATGAAATAGCTTTGGGGAAGGGTATCCAGAAGGATGGTACCTTACCTGAGGACTTGCAGGTTCGTTTGCCTCAC
TTACTGTTACGAATCAGATACTCACAATGTTTGATCAAGTGCCCCCATGATTCGCTAGTATGTATGCGAGCCATT
AACACTCGACCAAATCATCCTTCGGAGCCGCCAAGAATTCTTCAGGTCATCCCTGTCGCAACCCGTCACACCAAA
CCAAAGTTTCGTATCGCAAAGACAACTACGGGAACAGATATACAAGAGCCTCATCTCCAACTCACCGTTCAAGGA
TCAGAATATATGGGTATGAAGCAAAAAGCTGTATTTCACATTTACTGTGATGAGGTGAGACGGCACGTATCCATA
ATTTTGATATCAGTTAATTACATATCTCTAGAAATTACATGAAGCGTCAACTTCAGGGCAGCTCGATCATTTGTA
CCAATGGAAGGGATCTCATGTTTTCAGCTGGAGATCTGAACATGGTTGCCCAAAAATCACTACTCACGACAGCAA
GGACGACTCCGACAAGACGCCAGACAGCCATGAAGAAGAGGAGAACGAAACCACCCCGCCGGCCAATGTGCATGA
AGATGAAGACTCAATCATAAAAACACCATCACAAACACTCATATGGTTTATCTCATTAACGGCTAGCATTCTGTT
CGTTTTATCTTTCACTATCTCAAAACCGCATCATACCAATCTCAAAACTTTTGACAGTCTCGCCATCGCATTCCG
ATTTGTCTTTCTCAAACGATACAAGCATCATATCCTTCAATTGATCCACAAACTCCCTATATCTAGACGTCGTCA
TCGATCCGGTGAATACGACTTTCTACTAGAAGATATCGCATCGGAGGAATCCACCGTTTATTCGCCCGGATTTAG
AAAATACGACGCAGTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail