Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|017000
Gene name
Locationscaffold_10:552237..553538
Strand-
Gene length (bp)1301
Transcript length (bp)1248
Coding sequence length (bp)1248
Protein length (aa) 416

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07470 Glyco_hydro_88 Glycosyl Hydrolase Family 88 2.1E-14 141 258

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 4.37 1.55 7.20
Initials Initials knots 3.83 1.63 6.04
Pileal_Stipeal_center Stage I stipe center 1.43 0.45 2.40
Pileal_Stipeal_shell Stage I stipe shell 2.81 1.09 4.53
DIF_stipe_center Stage II stipe center 0.69 0.15 1.24
DIF_stipe_shell Stage II stipe shell 0.67 0.11 1.22
DIF_stipe_skin Stage II stipe skin 0.71 0.13 1.29
DIF_cap_skin Stage II cap skin 1.14 0.33 1.95
DIF_cap_tissue Stage II cap tissue 1.85 0.62 3.08
DIF_gill_tissue Stage II gill tissue 2.86 1.14 4.57
YFB_stipe_center Young fruiting body stipe center 0.46 0.06 0.85
YFB_stipe_shell Young fruiting body stipe shell 0.34 0.00 0.68
YFB_stipe_skin Young fruiting body stipe skin 0.61 0.11 1.11
YFB_cap_skin Young fruiting body cap skin 0.73 0.14 1.33
YFB_cap_tissue Young fruiting body cap tissue 0.56 0.09 1.04
YFB_gill_tissue Young fruiting body gill tissue 1.15 0.33 1.96
YFB_veil Young fruiting body veil 1.04 0.29 1.79

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.421233 no
Casing YFB_stipe_center 0.000613 yes
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.000613 yes
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.001625 yes
Casing YFB_veil 0.002525 yes
Casing Initials 0.861332 no
Casing Pileal_Stipeal_center 0.009123 yes
Casing Pileal_Stipeal_shell 0.411990 no
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.000613 yes
Casing DIF_cap_skin 0.002084 yes
Casing DIF_cap_tissue 0.052346 no
DIF_gill_tissue YFB_stipe_center 0.002525 yes
DIF_gill_tissue YFB_stipe_shell 0.001140 yes
DIF_gill_tissue YFB_stipe_skin 0.005302 yes
DIF_gill_tissue YFB_cap_skin 0.009123 yes
DIF_gill_tissue YFB_cap_tissue 0.003365 yes
DIF_gill_tissue YFB_gill_tissue 0.032978 yes
DIF_gill_tissue YFB_veil 0.026710 yes
YFB_stipe_center YFB_stipe_shell 0.779362 no
YFB_stipe_center YFB_stipe_skin 0.755264 no
YFB_stipe_center YFB_cap_skin 0.543414 no
YFB_stipe_center YFB_cap_tissue 0.838748 no
YFB_stipe_center YFB_gill_tissue 0.115496 no
YFB_stipe_center YFB_veil 0.184461 no
YFB_stipe_shell YFB_stipe_skin 0.460714 no
YFB_stipe_shell YFB_cap_skin 0.292427 no
YFB_stipe_shell YFB_cap_tissue 0.550636 no
YFB_stipe_shell YFB_gill_tissue 0.061662 no
YFB_stipe_shell YFB_veil 0.086416 no
YFB_stipe_skin YFB_cap_skin 0.854474 no
YFB_stipe_skin YFB_cap_tissue 0.940652 no
YFB_stipe_skin YFB_gill_tissue 0.288693 no
YFB_stipe_skin YFB_veil 0.426049 no
YFB_cap_skin YFB_cap_tissue 0.767719 no
YFB_cap_skin YFB_gill_tissue 0.504737 no
YFB_cap_skin YFB_veil 0.651673 no
YFB_cap_tissue YFB_gill_tissue 0.218856 no
YFB_cap_tissue YFB_veil 0.332527 no
YFB_gill_tissue YFB_veil 0.914224 no
Initials DIF_gill_tissue 0.590125 no
Initials YFB_stipe_center 0.000613 yes
Initials YFB_stipe_shell 0.000613 yes
Initials YFB_stipe_skin 0.002084 yes
Initials YFB_cap_skin 0.001140 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.003365 yes
Initials YFB_veil 0.004160 yes
Initials Pileal_Stipeal_center 0.021056 yes
Initials Pileal_Stipeal_shell 0.575268 no
Initials DIF_stipe_center 0.001140 yes
Initials DIF_stipe_shell 0.001140 yes
Initials DIF_stipe_skin 0.000613 yes
Initials DIF_cap_skin 0.004928 yes
Initials DIF_cap_tissue 0.076984 no
Pileal_Stipeal_center DIF_gill_tissue 0.139267 no
Pileal_Stipeal_center YFB_stipe_center 0.050499 no
Pileal_Stipeal_center YFB_stipe_shell 0.032978 yes
Pileal_Stipeal_center YFB_stipe_skin 0.126752 no
Pileal_Stipeal_center YFB_cap_skin 0.255805 no
Pileal_Stipeal_center YFB_cap_tissue 0.089301 no
Pileal_Stipeal_center YFB_gill_tissue 0.775312 no
Pileal_Stipeal_center YFB_veil 0.653065 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.162633 no
Pileal_Stipeal_center DIF_stipe_center 0.206924 no
Pileal_Stipeal_center DIF_stipe_shell 0.198062 no
Pileal_Stipeal_center DIF_stipe_skin 0.229919 no
Pileal_Stipeal_center DIF_cap_skin 0.764628 no
Pileal_Stipeal_center DIF_cap_tissue 0.698780 no
Pileal_Stipeal_shell DIF_gill_tissue 0.984144 no
Pileal_Stipeal_shell YFB_stipe_center 0.002525 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.001625 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.006032 yes
Pileal_Stipeal_shell YFB_cap_skin 0.010412 yes
Pileal_Stipeal_shell YFB_cap_tissue 0.003365 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.040279 yes
Pileal_Stipeal_shell YFB_veil 0.033906 yes
Pileal_Stipeal_shell DIF_stipe_center 0.006742 yes
Pileal_Stipeal_shell DIF_stipe_shell 0.006387 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.006742 yes
Pileal_Stipeal_shell DIF_cap_skin 0.043121 yes
Pileal_Stipeal_shell DIF_cap_tissue 0.427639 no
DIF_stipe_center DIF_gill_tissue 0.005671 yes
DIF_stipe_center YFB_stipe_center 0.615255 no
DIF_stipe_center YFB_stipe_shell 0.343177 no
DIF_stipe_center YFB_stipe_skin 0.908721 no
DIF_stipe_center YFB_cap_skin 0.959147 no
DIF_stipe_center YFB_cap_tissue 0.831541 no
DIF_stipe_center YFB_gill_tissue 0.426406 no
DIF_stipe_center YFB_veil 0.574986 no
DIF_stipe_center DIF_stipe_shell 0.974793 no
DIF_stipe_center DIF_stipe_skin 0.978217 no
DIF_stipe_center DIF_cap_skin 0.434257 no
DIF_stipe_center DIF_cap_tissue 0.056170 no
DIF_stipe_shell DIF_gill_tissue 0.008121 yes
DIF_stipe_shell YFB_stipe_center 0.664989 no
DIF_stipe_shell YFB_stipe_shell 0.386346 no
DIF_stipe_shell YFB_stipe_skin 0.937598 no
DIF_stipe_shell YFB_cap_skin 0.933232 no
DIF_stipe_shell YFB_cap_tissue 0.865616 no
DIF_stipe_shell YFB_gill_tissue 0.395587 no
DIF_stipe_shell YFB_veil 0.538952 no
DIF_stipe_shell DIF_stipe_skin 0.954245 no
DIF_stipe_shell DIF_cap_skin 0.405580 no
DIF_stipe_shell DIF_cap_tissue 0.056561 no
DIF_stipe_skin DIF_gill_tissue 0.006742 yes
DIF_stipe_skin YFB_stipe_center 0.582080 no
DIF_stipe_skin YFB_stipe_shell 0.316965 no
DIF_stipe_skin YFB_stipe_skin 0.880087 no
DIF_stipe_skin YFB_cap_skin 0.978899 no
DIF_stipe_skin YFB_cap_tissue 0.799725 no
DIF_stipe_skin YFB_gill_tissue 0.466859 no
DIF_stipe_skin YFB_veil 0.617359 no
DIF_stipe_skin DIF_cap_skin 0.473798 no
DIF_stipe_skin DIF_cap_tissue 0.067147 no
DIF_cap_skin DIF_gill_tissue 0.037364 yes
DIF_cap_skin YFB_stipe_center 0.120972 no
DIF_cap_skin YFB_stipe_shell 0.068830 no
DIF_cap_skin YFB_stipe_skin 0.296217 no
DIF_cap_skin YFB_cap_skin 0.505115 no
DIF_cap_skin YFB_cap_tissue 0.221932 no
DIF_cap_skin YFB_gill_tissue 0.992977 no
DIF_cap_skin YFB_veil 0.922442 no
DIF_cap_skin DIF_cap_tissue 0.366469 no
DIF_cap_tissue DIF_gill_tissue 0.386972 no
DIF_cap_tissue YFB_stipe_center 0.016949 yes
DIF_cap_tissue YFB_stipe_shell 0.013485 yes
DIF_cap_tissue YFB_stipe_skin 0.037818 yes
DIF_cap_tissue YFB_cap_skin 0.080708 no
DIF_cap_tissue YFB_cap_tissue 0.024187 yes
DIF_cap_tissue YFB_gill_tissue 0.379450 no
DIF_cap_tissue YFB_veil 0.282600 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|017000
MFPSQYHLTSPLLLFFLVSSTQSLKLSHPSSKFPFTHDPGFDIAKVAALGKSLPSHSWEYGTAAEALLELYDPEI
SVFSPSFLSKTSQYLRTHRGRIRSLEYAADVITLGTDQNALSHGGGAIADPASLGVSAILLGDYLKDGEKFADGA
TEQMGFTVGEAPRWENGAISHRLEAPELWADFVYMAPPFLAYYGLYNENLTLLEESVEQCRLYRQVLQASGGGLW
RHIVGPSSPDPGLWSTGNAWAAAGMARILAAVTNTPKSVFGKDTEKKYTRWRSDAIESLTGYITEILDGAIAAPK
DDGLLRNYLDDTSGGGHGFGEISGSTLLASVVYRMAVLQPKVFAKKGSEYLDWADGIMKTMGKGGHITENGTATP
AVNPLAWQDTKPFTTGSPEGQNFVVLMYVTWRDCVDAGIC*
Coding >AgabiH97|017000
ATGTTCCCATCTCAATACCATCTAACATCTCCCCTCCTCCTATTTTTCCTCGTTTCCTCAACCCAATCTTTGAAA
CTCTCTCATCCTTCCTCAAAATTCCCATTTACTCATGATCCCGGTTTCGATATCGCAAAGGTCGCAGCTCTGGGC
AAATCATTGCCTTCTCATTCCTGGGAATATGGCACAGCAGCAGAAGCTCTCCTCGAACTCTACGATCCTGAAATC
TCCGTATTCTCACCCTCCTTTCTCTCCAAAACGAGTCAATATCTGAGAACTCATCGAGGACGAATTCGTTCATTG
GAATACGCCGCAGATGTCATCACCCTTGGGACAGATCAAAATGCTCTATCACACGGTGGCGGTGCTATTGCTGAT
CCTGCGAGTCTGGGTGTAAGCGCTATTTTGTTGGGAGATTATTTGAAAGACGGGGAGAAATTTGCTGATGGTGCG
ACGGAGCAAATGGGTTTTACGGTTGGTGAAGCGCCGAGATGGGAGAATGGGGCGATATCGCATAGACTTGAGGCG
CCTGAATTATGGGCGGATTTTGTTTACATGGCCCCGCCGTTCCTGGCGTATTATGGGCTTTACAATGAAAACTTG
ACGCTGTTGGAGGAATCGGTAGAGCAGTGTAGGTTATATCGTCAAGTGCTGCAAGCTTCTGGTGGTGGATTATGG
CGACACATTGTCGGTCCTTCGTCACCCGACCCTGGTCTATGGTCAACGGGAAACGCATGGGCAGCTGCAGGAATG
GCACGAATTCTAGCCGCTGTCACCAACACTCCCAAATCCGTCTTTGGTAAAGATACCGAAAAGAAATATACTCGA
TGGAGGTCCGACGCTATTGAGTCGTTGACCGGCTATATCACCGAAATTTTGGATGGAGCGATAGCGGCGCCGAAA
GATGATGGTTTATTGAGGAATTACCTGGACGATACTTCAGGTGGTGGACATGGATTTGGTGAGATTTCGGGGAGC
ACTTTGTTGGCGAGTGTGGTGTATAGGATGGCTGTTCTGCAACCAAAGGTGTTTGCGAAGAAGGGGAGCGAGTAT
TTGGATTGGGCGGATGGGATTATGAAGACTATGGGTAAGGGTGGGCATATTACGGAAAATGGGACGGCGACGCCT
GCTGTGAATCCGCTTGCATGGCAGGACACGAAGCCATTTACTACTGGGAGTCCAGAGGGCCAGAATTTTGTAGTG
TTGATGTATGTGACCTGGAGGGATTGCGTTGATGCGGGGATCTGCTAG
Transcript >AgabiH97|017000
ATGTTCCCATCTCAATACCATCTAACATCTCCCCTCCTCCTATTTTTCCTCGTTTCCTCAACCCAATCTTTGAAA
CTCTCTCATCCTTCCTCAAAATTCCCATTTACTCATGATCCCGGTTTCGATATCGCAAAGGTCGCAGCTCTGGGC
AAATCATTGCCTTCTCATTCCTGGGAATATGGCACAGCAGCAGAAGCTCTCCTCGAACTCTACGATCCTGAAATC
TCCGTATTCTCACCCTCCTTTCTCTCCAAAACGAGTCAATATCTGAGAACTCATCGAGGACGAATTCGTTCATTG
GAATACGCCGCAGATGTCATCACCCTTGGGACAGATCAAAATGCTCTATCACACGGTGGCGGTGCTATTGCTGAT
CCTGCGAGTCTGGGTGTAAGCGCTATTTTGTTGGGAGATTATTTGAAAGACGGGGAGAAATTTGCTGATGGTGCG
ACGGAGCAAATGGGTTTTACGGTTGGTGAAGCGCCGAGATGGGAGAATGGGGCGATATCGCATAGACTTGAGGCG
CCTGAATTATGGGCGGATTTTGTTTACATGGCCCCGCCGTTCCTGGCGTATTATGGGCTTTACAATGAAAACTTG
ACGCTGTTGGAGGAATCGGTAGAGCAGTGTAGGTTATATCGTCAAGTGCTGCAAGCTTCTGGTGGTGGATTATGG
CGACACATTGTCGGTCCTTCGTCACCCGACCCTGGTCTATGGTCAACGGGAAACGCATGGGCAGCTGCAGGAATG
GCACGAATTCTAGCCGCTGTCACCAACACTCCCAAATCCGTCTTTGGTAAAGATACCGAAAAGAAATATACTCGA
TGGAGGTCCGACGCTATTGAGTCGTTGACCGGCTATATCACCGAAATTTTGGATGGAGCGATAGCGGCGCCGAAA
GATGATGGTTTATTGAGGAATTACCTGGACGATACTTCAGGTGGTGGACATGGATTTGGTGAGATTTCGGGGAGC
ACTTTGTTGGCGAGTGTGGTGTATAGGATGGCTGTTCTGCAACCAAAGGTGTTTGCGAAGAAGGGGAGCGAGTAT
TTGGATTGGGCGGATGGGATTATGAAGACTATGGGTAAGGGTGGGCATATTACGGAAAATGGGACGGCGACGCCT
GCTGTGAATCCGCTTGCATGGCAGGACACGAAGCCATTTACTACTGGGAGTCCAGAGGGCCAGAATTTTGTAGTG
TTGATGTATGTGACCTGGAGGGATTGCGTTGATGCGGGGATCTGCTAG
Gene >AgabiH97|017000
ATGTTCCCATCTCAATACCATCTAACATCTCCCCTCCTCCTATTTTTCCTCGTTTCCTCAACCCAATCTTTGAAA
CTCTCTCATCCTTCCTCAAAATTCCCATTTACTCATGATCCCGGTTTCGATATCGCAAAGGTCGCAGCTCTGGGC
AAATCATTGCCTTCTCATTCCTGGGAATATGGCACAGCAGCAGAAGCTCTCCTCGAACTCTACGATCCTGAAATC
TCCGTATTCTCACCCTCCTTTCTCTCCAAAACGAGTCAATATCTGAGAACTCATCGAGGACGAATTCGTTCATTG
GAATACGCCGCAGATGTCATCACCCTTGGGACAGATCAAAATGCTCTATCACACGGTGGCGGTGCTATTGCTGAT
CCTGCGAGTCTGGGTGTAAGCGCTATTTTGTTGGGAGATTATTTGAAAGACGGGGAGAAATTTGCTGATGGTGCG
ACGGAGCAAATGGGTTTTACGGTTGGTGAAGCGCCGAGATGGGAGAATGGGGCGATATCGCATAGACTTGAGGCG
CCTGAATTATGGTACGCATCATCGTATAATCTTAATTCCTTTTTCTAATAATAGTTCTTTGAAGGGCGGATTTTG
TTTACATGGCCCCGCCGTTCCTGGCGTATTATGGGCTTTACAATGAAAACTTGACGCTGTTGGAGGAATCGGTAG
AGCAGTGTAGGTTATATCGTCAAGTGCTGCAAGCTTCTGGTGGTGGATTATGGCGACACATTGTCGGTCCTTCGT
CACCCGACCCTGGTCTATGGTCAACGGGAAACGCATGGGCAGCTGCAGGAATGGCACGAATTCTAGCCGCTGTCA
CCAACACTCCCAAATCCGTCTTTGGTAAAGATACCGAAAAGAAATATACTCGATGGAGGTCCGACGCTATTGAGT
CGTTGACCGGCTATATCACCGAAATTTTGGATGGAGCGATAGCGGCGCCGAAAGATGATGGTTTATTGAGGAATT
ACCTGGACGATACTTCAGGTGGTGGACATGGATTTGGTGAGATTTCGGGGAGCACTTTGTTGGCGAGTGTGGTGT
ATAGGATGGCTGTTCTGCAACCAAAGGTGTTTGCGAAGAAGGGGAGCGAGTATTTGGATTGGGCGGATGGGATTA
TGAAGACTATGGGTAAGGGTGGGCATATTACGGAAAATGGGACGGCGACGCCTGCTGTGAATCCGCTTGCATGGC
AGGACACGAAGCCATTTACTACTGGGAGTCCAGAGGGCCAGAATTTTGTAGTGTTGATGTATGTGACCTGGAGGG
ATTGCGTTGATGCGGGGATCTGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail