Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|016860
Gene name
Locationscaffold_10:521871..522622
Strand+
Gene length (bp)751
Transcript length (bp)543
Coding sequence length (bp)543
Protein length (aa) 181

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10342 Kre9_KNH Kre9/KNH-like N-terminal Ig-like domain 1.7E-05 27 120

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 2012.46 744.61 3280.31
Initials Initials knots 574.78 338.22 811.34
Pileal_Stipeal_center Stage I stipe center 2373.49 1140.01 3606.98
Pileal_Stipeal_shell Stage I stipe shell 1457.20 743.46 2170.94
DIF_stipe_center Stage II stipe center 3269.47 1469.36 5069.58
DIF_stipe_shell Stage II stipe shell 3178.93 1444.25 4913.61
DIF_stipe_skin Stage II stipe skin 2541.82 1213.38 3870.26
DIF_cap_skin Stage II cap skin 2294.90 1131.66 3458.15
DIF_cap_tissue Stage II cap tissue 1808.79 931.12 2686.47
DIF_gill_tissue Stage II gill tissue 1870.63 952.52 2788.74
YFB_stipe_center Young fruiting body stipe center 3371.69 1472.50 5270.88
YFB_stipe_shell Young fruiting body stipe shell 4001.88 1692.67 6311.09
YFB_stipe_skin Young fruiting body stipe skin 3138.18 1435.72 4840.64
YFB_cap_skin Young fruiting body cap skin 2294.61 1134.60 3454.63
YFB_cap_tissue Young fruiting body cap tissue 3226.97 1409.47 5044.47
YFB_gill_tissue Young fruiting body gill tissue 2230.32 1082.91 3377.72
YFB_veil Young fruiting body veil 2077.53 1012.99 3142.07

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.916767 no
Casing YFB_stipe_center 0.234408 no
Casing YFB_stipe_shell 0.084360 no
Casing YFB_stipe_skin 0.323063 no
Casing YFB_cap_skin 0.839167 no
Casing YFB_cap_tissue 0.288092 no
Casing YFB_gill_tissue 0.875628 no
Casing YFB_veil 0.965348 no
Casing Initials 0.000613 yes
Casing Pileal_Stipeal_center 0.789255 no
Casing Pileal_Stipeal_shell 0.494814 no
Casing DIF_stipe_center 0.257979 no
Casing DIF_stipe_shell 0.303559 no
Casing DIF_stipe_skin 0.669865 no
Casing DIF_cap_skin 0.837463 no
Casing DIF_cap_tissue 0.866813 no
DIF_gill_tissue YFB_stipe_center 0.109622 no
DIF_gill_tissue YFB_stipe_shell 0.030372 yes
DIF_gill_tissue YFB_stipe_skin 0.171800 no
DIF_gill_tissue YFB_cap_skin 0.682303 no
DIF_gill_tissue YFB_cap_tissue 0.148373 no
DIF_gill_tissue YFB_gill_tissue 0.732173 no
DIF_gill_tissue YFB_veil 0.860124 no
YFB_stipe_center YFB_stipe_shell 0.778966 no
YFB_stipe_center YFB_stipe_skin 0.918397 no
YFB_stipe_center YFB_cap_skin 0.376873 no
YFB_stipe_center YFB_cap_tissue 0.954469 no
YFB_stipe_center YFB_gill_tissue 0.324874 no
YFB_stipe_center YFB_veil 0.219084 no
YFB_stipe_shell YFB_stipe_skin 0.641252 no
YFB_stipe_shell YFB_cap_skin 0.140001 no
YFB_stipe_shell YFB_cap_tissue 0.700039 no
YFB_stipe_shell YFB_gill_tissue 0.115194 no
YFB_stipe_shell YFB_veil 0.068461 no
YFB_stipe_skin YFB_cap_skin 0.495767 no
YFB_stipe_skin YFB_cap_tissue 0.971294 no
YFB_stipe_skin YFB_gill_tissue 0.432990 no
YFB_stipe_skin YFB_veil 0.309002 no
YFB_cap_skin YFB_cap_tissue 0.453914 no
YFB_cap_skin YFB_gill_tissue 0.967364 no
YFB_cap_skin YFB_veil 0.870539 no
YFB_cap_tissue YFB_gill_tissue 0.397375 no
YFB_cap_tissue YFB_veil 0.285921 no
YFB_gill_tissue YFB_veil 0.911933 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.000613 yes
Initials YFB_stipe_shell 0.000613 yes
Initials YFB_stipe_skin 0.000613 yes
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.000613 yes
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.000613 yes
Initials Pileal_Stipeal_shell 0.003365 yes
Initials DIF_stipe_center 0.000613 yes
Initials DIF_stipe_shell 0.000613 yes
Initials DIF_stipe_skin 0.000613 yes
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.622614 no
Pileal_Stipeal_center YFB_stipe_center 0.445361 no
Pileal_Stipeal_center YFB_stipe_shell 0.192906 no
Pileal_Stipeal_center YFB_stipe_skin 0.565126 no
Pileal_Stipeal_center YFB_cap_skin 0.962482 no
Pileal_Stipeal_center YFB_cap_tissue 0.526338 no
Pileal_Stipeal_center YFB_gill_tissue 0.925366 no
Pileal_Stipeal_center YFB_veil 0.818978 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.199031 no
Pileal_Stipeal_center DIF_stipe_center 0.484474 no
Pileal_Stipeal_center DIF_stipe_shell 0.540050 no
Pileal_Stipeal_center DIF_stipe_skin 0.921415 no
Pileal_Stipeal_center DIF_cap_skin 0.961647 no
Pileal_Stipeal_center DIF_cap_tissue 0.544399 no
Pileal_Stipeal_shell DIF_gill_tissue 0.585870 no
Pileal_Stipeal_shell YFB_stipe_center 0.015529 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.002084 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.027698 yes
Pileal_Stipeal_shell YFB_cap_skin 0.224601 no
Pileal_Stipeal_shell YFB_cap_tissue 0.019987 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.263495 no
Pileal_Stipeal_shell YFB_veil 0.377838 no
Pileal_Stipeal_shell DIF_stipe_center 0.019987 yes
Pileal_Stipeal_shell DIF_stipe_shell 0.028193 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.125142 no
Pileal_Stipeal_shell DIF_cap_skin 0.224926 no
Pileal_Stipeal_shell DIF_cap_tissue 0.643533 no
DIF_stipe_center DIF_gill_tissue 0.133711 no
DIF_stipe_center YFB_stipe_center 0.968331 no
DIF_stipe_center YFB_stipe_shell 0.720740 no
DIF_stipe_center YFB_stipe_skin 0.955961 no
DIF_stipe_center YFB_cap_skin 0.414413 no
DIF_stipe_center YFB_cap_tissue 0.985782 no
DIF_stipe_center YFB_gill_tissue 0.359432 no
DIF_stipe_center YFB_veil 0.246828 no
DIF_stipe_center DIF_stipe_shell 0.969973 no
DIF_stipe_center DIF_stipe_skin 0.613387 no
DIF_stipe_center DIF_cap_skin 0.415885 no
DIF_stipe_center DIF_cap_tissue 0.095802 no
DIF_stipe_shell DIF_gill_tissue 0.159049 no
DIF_stipe_shell YFB_stipe_center 0.936048 no
DIF_stipe_shell YFB_stipe_shell 0.666886 no
DIF_stipe_shell YFB_stipe_skin 0.985644 no
DIF_stipe_shell YFB_cap_skin 0.468757 no
DIF_stipe_shell YFB_cap_tissue 0.984165 no
DIF_stipe_shell YFB_gill_tissue 0.405974 no
DIF_stipe_shell YFB_veil 0.286119 no
DIF_stipe_shell DIF_stipe_skin 0.665426 no
DIF_stipe_shell DIF_cap_skin 0.467805 no
DIF_stipe_shell DIF_cap_tissue 0.112416 no
DIF_stipe_skin DIF_gill_tissue 0.488978 no
DIF_stipe_skin YFB_stipe_center 0.571670 no
DIF_stipe_skin YFB_stipe_shell 0.272636 no
DIF_stipe_skin YFB_stipe_skin 0.687161 no
DIF_stipe_skin YFB_cap_skin 0.870539 no
DIF_stipe_skin YFB_cap_tissue 0.646942 no
DIF_stipe_skin YFB_gill_tissue 0.821168 no
DIF_stipe_skin YFB_veil 0.694381 no
DIF_stipe_skin DIF_cap_skin 0.868764 no
DIF_stipe_skin DIF_cap_tissue 0.406997 no
DIF_cap_skin DIF_gill_tissue 0.678432 no
DIF_cap_skin YFB_stipe_center 0.372922 no
DIF_cap_skin YFB_stipe_shell 0.150706 no
DIF_cap_skin YFB_stipe_skin 0.489586 no
DIF_cap_skin YFB_cap_skin 0.999713 no
DIF_cap_skin YFB_cap_tissue 0.450378 no
DIF_cap_skin YFB_gill_tissue 0.967084 no
DIF_cap_skin YFB_veil 0.870218 no
DIF_cap_skin DIF_cap_tissue 0.601162 no
DIF_cap_tissue DIF_gill_tissue 0.959263 no
DIF_cap_tissue YFB_stipe_center 0.081058 no
DIF_cap_tissue YFB_stipe_shell 0.020260 yes
DIF_cap_tissue YFB_stipe_skin 0.128665 no
DIF_cap_tissue YFB_cap_skin 0.599131 no
DIF_cap_tissue YFB_cap_tissue 0.110551 no
DIF_cap_tissue YFB_gill_tissue 0.654377 no
DIF_cap_tissue YFB_veil 0.797410 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|016860
MVALSALALALSAASLAAAQSTFQITNPSADHWWVAESSNVLTWDCKNNPHTTFGVFIANADQTLFAGDLAIIPQ
QPNADCSKEITHNQVNQPPGSGYIIKFANAVNSSEVFAQSDQFEIRPLGSAFPTTSSPAGNSPSNTADNTAAGAS
STDTPNGAASLKTLGVGFTAAAAGALAYLM*
Coding >AgabiH97|016860
ATGGTCGCCCTCTCCGCCCTCGCCCTTGCTCTCTCTGCCGCCAGCCTTGCCGCTGCCCAGTCCACCTTCCAGATC
ACCAATCCCTCCGCGGACCACTGGTGGGTTGCTGAATCGTCGAATGTTCTTACTTGGGACTGCAAGAACAACCCA
CATACCACCTTTGGTGTTTTCATTGCCAACGCAGACCAAACATTGTTTGCAGGAGACCTCGCTATTATCCCTCAA
CAGCCTAATGCCGATTGCTCCAAGGAAATCACTCACAACCAAGTCAACCAACCTCCCGGCAGTGGCTACATAATC
AAGTTCGCCAACGCTGTCAACAGCTCAGAGGTCTTTGCTCAATCTGACCAGTTCGAGATCAGACCTCTCGGTTCT
GCGTTCCCCACTACCTCGTCACCAGCAGGTAATAGCCCATCCAATACCGCAGACAACACAGCCGCCGGTGCTTCA
TCCACTGACACACCCAACGGCGCCGCCTCTCTCAAAACTCTCGGTGTCGGTTTCACCGCTGCCGCAGCTGGTGCC
TTGGCGTATCTCATGTGA
Transcript >AgabiH97|016860
ATGGTCGCCCTCTCCGCCCTCGCCCTTGCTCTCTCTGCCGCCAGCCTTGCCGCTGCCCAGTCCACCTTCCAGATC
ACCAATCCCTCCGCGGACCACTGGTGGGTTGCTGAATCGTCGAATGTTCTTACTTGGGACTGCAAGAACAACCCA
CATACCACCTTTGGTGTTTTCATTGCCAACGCAGACCAAACATTGTTTGCAGGAGACCTCGCTATTATCCCTCAA
CAGCCTAATGCCGATTGCTCCAAGGAAATCACTCACAACCAAGTCAACCAACCTCCCGGCAGTGGCTACATAATC
AAGTTCGCCAACGCTGTCAACAGCTCAGAGGTCTTTGCTCAATCTGACCAGTTCGAGATCAGACCTCTCGGTTCT
GCGTTCCCCACTACCTCGTCACCAGCAGGTAATAGCCCATCCAATACCGCAGACAACACAGCCGCCGGTGCTTCA
TCCACTGACACACCCAACGGCGCCGCCTCTCTCAAAACTCTCGGTGTCGGTTTCACCGCTGCCGCAGCTGGTGCC
TTGGCGTATCTCATGTGA
Gene >AgabiH97|016860
ATGGTCGCCCTCTCCGCCCTCGCCCTTGCTCTCTCTGCCGCCAGCCTTGCCGCTGCCCAGTCCACCTTCCAGATC
ACCAATCCCTCCGCGGACCACTGGTGGGGTGAGCTGTCGTCTTTTCTTCCTAGCTACAAACACAACTGACAGAAA
CTAGTTGCTGAATCGTCGAATGTTCTTACTTGGGACTGCAAGAACAACCCACATACCACCTTTGGTGTTTTGTAC
GTGTCTGGCTCCCCACTTCACTGGCCTGTTCTCACGCCTCTCTCTCGTCTAGCATTGCCAACGCAGTATGGCTAC
TCGTTAGCATAAAATAAAATAATTATACTCATCCATTTCACAGGACCAAACATTGTTTGCAGGAGACCTCGCTAT
TATCCCTCAACAGCCTAATGCCGATTGCTCCAAGGAAATCACTCACAACCAAGTCAACCAACCTCCCGGCAGTGG
CTACATAATCAAGTTCGCCAACGCTGTCAACAGCTCAGAGGTACGTTTTTCCCGCTCTTCGCTCCAACCCGTGCT
GATCCTTTCAAAGGTCTTTGCTCAATCTGACCAGTTCGAGATCAGACCTCTCGGTTCTGCGTTCCCCACTACCTC
GTCACCAGCAGGTAATAGCCCATCCAATACCGCAGACAACACAGCCGCCGGTGCTTCATCCACTGACACACCCAA
CGGCGCCGCCTCTCTCAAAACTCTCGGTGTCGGTTTCACCGCTGCCGCAGCTGGTGCCTTGGCGTATCTCATGTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail