© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|016860 |
| Gene name | |
| Location | scaffold_10:521871..522622 |
| Strand | + |
| Gene length (bp) | 751 |
| Transcript length (bp) | 543 |
| Coding sequence length (bp) | 543 |
| Protein length (aa) | 181 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF10342 | Kre9_KNH | Kre9/KNH-like N-terminal Ig-like domain | 1.7E-05 | 27 | 120 |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| Yes | 1 - 20 | 0.45 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 2012.46 | 744.61 | 3280.31 |
| Initials | Initials knots | 574.78 | 338.22 | 811.34 |
| Pileal_Stipeal_center | Stage I stipe center | 2373.49 | 1140.01 | 3606.98 |
| Pileal_Stipeal_shell | Stage I stipe shell | 1457.20 | 743.46 | 2170.94 |
| DIF_stipe_center | Stage II stipe center | 3269.47 | 1469.36 | 5069.58 |
| DIF_stipe_shell | Stage II stipe shell | 3178.93 | 1444.25 | 4913.61 |
| DIF_stipe_skin | Stage II stipe skin | 2541.82 | 1213.38 | 3870.26 |
| DIF_cap_skin | Stage II cap skin | 2294.90 | 1131.66 | 3458.15 |
| DIF_cap_tissue | Stage II cap tissue | 1808.79 | 931.12 | 2686.47 |
| DIF_gill_tissue | Stage II gill tissue | 1870.63 | 952.52 | 2788.74 |
| YFB_stipe_center | Young fruiting body stipe center | 3371.69 | 1472.50 | 5270.88 |
| YFB_stipe_shell | Young fruiting body stipe shell | 4001.88 | 1692.67 | 6311.09 |
| YFB_stipe_skin | Young fruiting body stipe skin | 3138.18 | 1435.72 | 4840.64 |
| YFB_cap_skin | Young fruiting body cap skin | 2294.61 | 1134.60 | 3454.63 |
| YFB_cap_tissue | Young fruiting body cap tissue | 3226.97 | 1409.47 | 5044.47 |
| YFB_gill_tissue | Young fruiting body gill tissue | 2230.32 | 1082.91 | 3377.72 |
| YFB_veil | Young fruiting body veil | 2077.53 | 1012.99 | 3142.07 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.916767 | no |
| Casing | YFB_stipe_center | 0.234408 | no |
| Casing | YFB_stipe_shell | 0.084360 | no |
| Casing | YFB_stipe_skin | 0.323063 | no |
| Casing | YFB_cap_skin | 0.839167 | no |
| Casing | YFB_cap_tissue | 0.288092 | no |
| Casing | YFB_gill_tissue | 0.875628 | no |
| Casing | YFB_veil | 0.965348 | no |
| Casing | Initials | 0.000613 | yes |
| Casing | Pileal_Stipeal_center | 0.789255 | no |
| Casing | Pileal_Stipeal_shell | 0.494814 | no |
| Casing | DIF_stipe_center | 0.257979 | no |
| Casing | DIF_stipe_shell | 0.303559 | no |
| Casing | DIF_stipe_skin | 0.669865 | no |
| Casing | DIF_cap_skin | 0.837463 | no |
| Casing | DIF_cap_tissue | 0.866813 | no |
| DIF_gill_tissue | YFB_stipe_center | 0.109622 | no |
| DIF_gill_tissue | YFB_stipe_shell | 0.030372 | yes |
| DIF_gill_tissue | YFB_stipe_skin | 0.171800 | no |
| DIF_gill_tissue | YFB_cap_skin | 0.682303 | no |
| DIF_gill_tissue | YFB_cap_tissue | 0.148373 | no |
| DIF_gill_tissue | YFB_gill_tissue | 0.732173 | no |
| DIF_gill_tissue | YFB_veil | 0.860124 | no |
| YFB_stipe_center | YFB_stipe_shell | 0.778966 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.918397 | no |
| YFB_stipe_center | YFB_cap_skin | 0.376873 | no |
| YFB_stipe_center | YFB_cap_tissue | 0.954469 | no |
| YFB_stipe_center | YFB_gill_tissue | 0.324874 | no |
| YFB_stipe_center | YFB_veil | 0.219084 | no |
| YFB_stipe_shell | YFB_stipe_skin | 0.641252 | no |
| YFB_stipe_shell | YFB_cap_skin | 0.140001 | no |
| YFB_stipe_shell | YFB_cap_tissue | 0.700039 | no |
| YFB_stipe_shell | YFB_gill_tissue | 0.115194 | no |
| YFB_stipe_shell | YFB_veil | 0.068461 | no |
| YFB_stipe_skin | YFB_cap_skin | 0.495767 | no |
| YFB_stipe_skin | YFB_cap_tissue | 0.971294 | no |
| YFB_stipe_skin | YFB_gill_tissue | 0.432990 | no |
| YFB_stipe_skin | YFB_veil | 0.309002 | no |
| YFB_cap_skin | YFB_cap_tissue | 0.453914 | no |
| YFB_cap_skin | YFB_gill_tissue | 0.967364 | no |
| YFB_cap_skin | YFB_veil | 0.870539 | no |
| YFB_cap_tissue | YFB_gill_tissue | 0.397375 | no |
| YFB_cap_tissue | YFB_veil | 0.285921 | no |
| YFB_gill_tissue | YFB_veil | 0.911933 | no |
| Initials | DIF_gill_tissue | 0.000613 | yes |
| Initials | YFB_stipe_center | 0.000613 | yes |
| Initials | YFB_stipe_shell | 0.000613 | yes |
| Initials | YFB_stipe_skin | 0.000613 | yes |
| Initials | YFB_cap_skin | 0.000613 | yes |
| Initials | YFB_cap_tissue | 0.000613 | yes |
| Initials | YFB_gill_tissue | 0.000613 | yes |
| Initials | YFB_veil | 0.000613 | yes |
| Initials | Pileal_Stipeal_center | 0.000613 | yes |
| Initials | Pileal_Stipeal_shell | 0.003365 | yes |
| Initials | DIF_stipe_center | 0.000613 | yes |
| Initials | DIF_stipe_shell | 0.000613 | yes |
| Initials | DIF_stipe_skin | 0.000613 | yes |
| Initials | DIF_cap_skin | 0.000613 | yes |
| Initials | DIF_cap_tissue | 0.000613 | yes |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.622614 | no |
| Pileal_Stipeal_center | YFB_stipe_center | 0.445361 | no |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.192906 | no |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.565126 | no |
| Pileal_Stipeal_center | YFB_cap_skin | 0.962482 | no |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.526338 | no |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.925366 | no |
| Pileal_Stipeal_center | YFB_veil | 0.818978 | no |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.199031 | no |
| Pileal_Stipeal_center | DIF_stipe_center | 0.484474 | no |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.540050 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.921415 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.961647 | no |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.544399 | no |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.585870 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.015529 | yes |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.002084 | yes |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.027698 | yes |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.224601 | no |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.019987 | yes |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.263495 | no |
| Pileal_Stipeal_shell | YFB_veil | 0.377838 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.019987 | yes |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.028193 | yes |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.125142 | no |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.224926 | no |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.643533 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.133711 | no |
| DIF_stipe_center | YFB_stipe_center | 0.968331 | no |
| DIF_stipe_center | YFB_stipe_shell | 0.720740 | no |
| DIF_stipe_center | YFB_stipe_skin | 0.955961 | no |
| DIF_stipe_center | YFB_cap_skin | 0.414413 | no |
| DIF_stipe_center | YFB_cap_tissue | 0.985782 | no |
| DIF_stipe_center | YFB_gill_tissue | 0.359432 | no |
| DIF_stipe_center | YFB_veil | 0.246828 | no |
| DIF_stipe_center | DIF_stipe_shell | 0.969973 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.613387 | no |
| DIF_stipe_center | DIF_cap_skin | 0.415885 | no |
| DIF_stipe_center | DIF_cap_tissue | 0.095802 | no |
| DIF_stipe_shell | DIF_gill_tissue | 0.159049 | no |
| DIF_stipe_shell | YFB_stipe_center | 0.936048 | no |
| DIF_stipe_shell | YFB_stipe_shell | 0.666886 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.985644 | no |
| DIF_stipe_shell | YFB_cap_skin | 0.468757 | no |
| DIF_stipe_shell | YFB_cap_tissue | 0.984165 | no |
| DIF_stipe_shell | YFB_gill_tissue | 0.405974 | no |
| DIF_stipe_shell | YFB_veil | 0.286119 | no |
| DIF_stipe_shell | DIF_stipe_skin | 0.665426 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.467805 | no |
| DIF_stipe_shell | DIF_cap_tissue | 0.112416 | no |
| DIF_stipe_skin | DIF_gill_tissue | 0.488978 | no |
| DIF_stipe_skin | YFB_stipe_center | 0.571670 | no |
| DIF_stipe_skin | YFB_stipe_shell | 0.272636 | no |
| DIF_stipe_skin | YFB_stipe_skin | 0.687161 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.870539 | no |
| DIF_stipe_skin | YFB_cap_tissue | 0.646942 | no |
| DIF_stipe_skin | YFB_gill_tissue | 0.821168 | no |
| DIF_stipe_skin | YFB_veil | 0.694381 | no |
| DIF_stipe_skin | DIF_cap_skin | 0.868764 | no |
| DIF_stipe_skin | DIF_cap_tissue | 0.406997 | no |
| DIF_cap_skin | DIF_gill_tissue | 0.678432 | no |
| DIF_cap_skin | YFB_stipe_center | 0.372922 | no |
| DIF_cap_skin | YFB_stipe_shell | 0.150706 | no |
| DIF_cap_skin | YFB_stipe_skin | 0.489586 | no |
| DIF_cap_skin | YFB_cap_skin | 0.999713 | no |
| DIF_cap_skin | YFB_cap_tissue | 0.450378 | no |
| DIF_cap_skin | YFB_gill_tissue | 0.967084 | no |
| DIF_cap_skin | YFB_veil | 0.870218 | no |
| DIF_cap_skin | DIF_cap_tissue | 0.601162 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.959263 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.081058 | no |
| DIF_cap_tissue | YFB_stipe_shell | 0.020260 | yes |
| DIF_cap_tissue | YFB_stipe_skin | 0.128665 | no |
| DIF_cap_tissue | YFB_cap_skin | 0.599131 | no |
| DIF_cap_tissue | YFB_cap_tissue | 0.110551 | no |
| DIF_cap_tissue | YFB_gill_tissue | 0.654377 | no |
| DIF_cap_tissue | YFB_veil | 0.797410 | no |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|016860 MVALSALALALSAASLAAAQSTFQITNPSADHWWVAESSNVLTWDCKNNPHTTFGVFIANADQTLFAGDLAIIPQ QPNADCSKEITHNQVNQPPGSGYIIKFANAVNSSEVFAQSDQFEIRPLGSAFPTTSSPAGNSPSNTADNTAAGAS STDTPNGAASLKTLGVGFTAAAAGALAYLM* |
| Coding | >AgabiH97|016860 ATGGTCGCCCTCTCCGCCCTCGCCCTTGCTCTCTCTGCCGCCAGCCTTGCCGCTGCCCAGTCCACCTTCCAGATC ACCAATCCCTCCGCGGACCACTGGTGGGTTGCTGAATCGTCGAATGTTCTTACTTGGGACTGCAAGAACAACCCA CATACCACCTTTGGTGTTTTCATTGCCAACGCAGACCAAACATTGTTTGCAGGAGACCTCGCTATTATCCCTCAA CAGCCTAATGCCGATTGCTCCAAGGAAATCACTCACAACCAAGTCAACCAACCTCCCGGCAGTGGCTACATAATC AAGTTCGCCAACGCTGTCAACAGCTCAGAGGTCTTTGCTCAATCTGACCAGTTCGAGATCAGACCTCTCGGTTCT GCGTTCCCCACTACCTCGTCACCAGCAGGTAATAGCCCATCCAATACCGCAGACAACACAGCCGCCGGTGCTTCA TCCACTGACACACCCAACGGCGCCGCCTCTCTCAAAACTCTCGGTGTCGGTTTCACCGCTGCCGCAGCTGGTGCC TTGGCGTATCTCATGTGA |
| Transcript | >AgabiH97|016860 ATGGTCGCCCTCTCCGCCCTCGCCCTTGCTCTCTCTGCCGCCAGCCTTGCCGCTGCCCAGTCCACCTTCCAGATC ACCAATCCCTCCGCGGACCACTGGTGGGTTGCTGAATCGTCGAATGTTCTTACTTGGGACTGCAAGAACAACCCA CATACCACCTTTGGTGTTTTCATTGCCAACGCAGACCAAACATTGTTTGCAGGAGACCTCGCTATTATCCCTCAA CAGCCTAATGCCGATTGCTCCAAGGAAATCACTCACAACCAAGTCAACCAACCTCCCGGCAGTGGCTACATAATC AAGTTCGCCAACGCTGTCAACAGCTCAGAGGTCTTTGCTCAATCTGACCAGTTCGAGATCAGACCTCTCGGTTCT GCGTTCCCCACTACCTCGTCACCAGCAGGTAATAGCCCATCCAATACCGCAGACAACACAGCCGCCGGTGCTTCA TCCACTGACACACCCAACGGCGCCGCCTCTCTCAAAACTCTCGGTGTCGGTTTCACCGCTGCCGCAGCTGGTGCC TTGGCGTATCTCATGTGA |
| Gene | >AgabiH97|016860 ATGGTCGCCCTCTCCGCCCTCGCCCTTGCTCTCTCTGCCGCCAGCCTTGCCGCTGCCCAGTCCACCTTCCAGATC ACCAATCCCTCCGCGGACCACTGGTGGGGTGAGCTGTCGTCTTTTCTTCCTAGCTACAAACACAACTGACAGAAA CTAGTTGCTGAATCGTCGAATGTTCTTACTTGGGACTGCAAGAACAACCCACATACCACCTTTGGTGTTTTGTAC GTGTCTGGCTCCCCACTTCACTGGCCTGTTCTCACGCCTCTCTCTCGTCTAGCATTGCCAACGCAGTATGGCTAC TCGTTAGCATAAAATAAAATAATTATACTCATCCATTTCACAGGACCAAACATTGTTTGCAGGAGACCTCGCTAT TATCCCTCAACAGCCTAATGCCGATTGCTCCAAGGAAATCACTCACAACCAAGTCAACCAACCTCCCGGCAGTGG CTACATAATCAAGTTCGCCAACGCTGTCAACAGCTCAGAGGTACGTTTTTCCCGCTCTTCGCTCCAACCCGTGCT GATCCTTTCAAAGGTCTTTGCTCAATCTGACCAGTTCGAGATCAGACCTCTCGGTTCTGCGTTCCCCACTACCTC GTCACCAGCAGGTAATAGCCCATCCAATACCGCAGACAACACAGCCGCCGGTGCTTCATCCACTGACACACCCAA CGGCGCCGCCTCTCTCAAAACTCTCGGTGTCGGTTTCACCGCTGCCGCAGCTGGTGCCTTGGCGTATCTCATGTG A |