Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|016820
Gene name
Locationscaffold_10:508742..510625
Strand+
Gene length (bp)1883
Transcript length (bp)1374
Coding sequence length (bp)1374
Protein length (aa) 458

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08288 PIGA PIGA (GPI anchor biosynthesis) 7.2E-37 45 133
PF13439 Glyco_transf_4 Glycosyltransferase Family 4 1.5E-24 17 163
PF00534 Glycos_transf_1 Glycosyl transferases group 1 1.8E-24 199 347
PF13692 Glyco_trans_1_4 Glycosyl transferases group 1 2.4E-21 211 346
PF13579 Glyco_trans_4_4 Glycosyl transferase 4-like domain 1.5E-09 18 162

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87172|GPI3_SCHPO Phosphatidylinositol N-acetylglucosaminyltransferase gpi3 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi3 PE=3 SV=1 8 434 2.0E-144
sp|P37287|PIGA_HUMAN Phosphatidylinositol N-acetylglucosaminyltransferase subunit A OS=Homo sapiens GN=PIGA PE=1 SV=1 6 434 7.0E-133
sp|Q64323|PIGA_MOUSE N-acetylglucosaminyl-phosphatidylinositol biosynthetic protein OS=Mus musculus GN=Piga PE=2 SV=1 6 434 2.0E-128
sp|A6ZW78|GPI3_YEAS7 Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain YJM789) GN=SPT14 PE=3 SV=1 6 434 2.0E-126
sp|P32363|GPI3_YEAST Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT14 PE=1 SV=4 6 434 3.0E-126
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87172|GPI3_SCHPO Phosphatidylinositol N-acetylglucosaminyltransferase gpi3 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi3 PE=3 SV=1 8 434 2.0E-144
sp|P37287|PIGA_HUMAN Phosphatidylinositol N-acetylglucosaminyltransferase subunit A OS=Homo sapiens GN=PIGA PE=1 SV=1 6 434 7.0E-133
sp|Q64323|PIGA_MOUSE N-acetylglucosaminyl-phosphatidylinositol biosynthetic protein OS=Mus musculus GN=Piga PE=2 SV=1 6 434 2.0E-128
sp|A6ZW78|GPI3_YEAS7 Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain YJM789) GN=SPT14 PE=3 SV=1 6 434 2.0E-126
sp|P32363|GPI3_YEAST Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT14 PE=1 SV=4 6 434 3.0E-126
sp|B5VSZ6|GPI3_YEAS6 Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain AWRI1631) GN=SPT14 PE=3 SV=2 6 434 3.0E-126
sp|B3LKQ3|GPI3_YEAS1 Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SPT14 PE=3 SV=1 6 434 3.0E-126
sp|Q8CWR6|AMGDS_STRR6 Alpha-monoglucosyldiacylglycerol synthase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=spr0982 PE=1 SV=1 4 314 3.0E-15
sp|P9WMY9|GLGSY_MYCTU Glycogen synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3032 PE=1 SV=1 187 394 2.0E-13
sp|P9WMY8|GLGSY_MYCTO Glycogen synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT3116 PE=3 SV=1 187 394 2.0E-13
sp|Q4H4F8|BTRM_BACCI 2-deoxystreptamine N-acetyl-D-glucosaminyltransferase OS=Bacillus circulans GN=btrM PE=3 SV=1 211 350 9.0E-11
sp|Q81ST7|BSHA_BACAN N-acetyl-alpha-D-glucosaminyl L-malate synthase OS=Bacillus anthracis GN=bshA PE=1 SV=1 14 393 4.0E-10
sp|Q59002|Y1607_METJA Uncharacterized glycosyltransferase MJ1607 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1607 PE=3 SV=1 4 386 1.0E-09
sp|P0CF99|PIMC_MYCTO GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol dimannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pimC PE=1 SV=1 4 391 2.0E-09
sp|A5U3B9|PIMC_MYCTA GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol dimannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pimC PE=3 SV=1 4 391 2.0E-09
sp|P42982|BSHA_BACSU N-acetyl-alpha-D-glucosaminyl L-malate synthase OS=Bacillus subtilis (strain 168) GN=bshA PE=1 SV=2 1 386 4.0E-09
sp|Q4JSW2|MSHA_CORJK D-inositol 3-phosphate glycosyltransferase OS=Corynebacterium jeikeium (strain K411) GN=mshA PE=3 SV=1 4 381 4.0E-09
sp|Q8S4F6|SQD2_ARATH Sulfoquinovosyl transferase SQD2 OS=Arabidopsis thaliana GN=SQD2 PE=1 SV=1 212 384 8.0E-09
sp|D6Z995|MSHA_SEGRD D-inositol 3-phosphate glycosyltransferase OS=Segniliparus rotundus (strain ATCC BAA-972 / CDC 1076 / CIP 108378 / DSM 44985 / JCM 13578) GN=mshA PE=3 SV=1 16 352 2.0E-08
sp|P71243|WCAL_ECOLI Putative colanic acid biosynthesis glycosyltransferase WcaL OS=Escherichia coli (strain K12) GN=wcaL PE=3 SV=2 198 337 3.0E-08
sp|Q93P60|AMGDS_ACHLA Alpha-monoglucosyldiacylglycerol synthase OS=Acholeplasma laidlawii GN=mgs PE=1 SV=1 4 313 3.0E-08
sp|P9WMZ1|GLGA_MYCTU Capsular glucan synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=glgA PE=1 SV=1 96 384 4.0E-08
sp|P9WMZ0|GLGA_MYCTO Capsular glucan synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=glgA PE=3 SV=1 96 384 4.0E-08
sp|Q53U18|NEOD_STRFR 2-deoxystreptamine N-acetyl-D-glucosaminyltransferase OS=Streptomyces fradiae GN=neoD PE=1 SV=1 17 348 5.0E-08
sp|A4QB40|MSHA_CORGB D-inositol 3-phosphate glycosyltransferase OS=Corynebacterium glutamicum (strain R) GN=mshA PE=3 SV=1 4 321 5.0E-08
sp|P9WMZ2|PIMB_MYCTO GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pimB PE=3 SV=1 186 376 5.0E-08
sp|B1VEI4|MSHA_CORU7 D-inositol 3-phosphate glycosyltransferase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=mshA PE=3 SV=1 4 395 5.0E-08
sp|Q8NTA6|MSHA_CORGL D-inositol 3-phosphate glycosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=mshA PE=1 SV=1 4 321 5.0E-08
sp|P9WMZ3|PIMB_MYCTU GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pimB PE=1 SV=1 186 376 5.0E-08
sp|A0QWG6|PIMA_MYCS2 GDP-mannose-dependent alpha-(1-2)-phosphatidylinositol mannosyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=pimA PE=1 SV=1 190 384 8.0E-08
sp|Q9AET5|GTF1_STRGN Glycosyltransferase Gtf1 OS=Streptococcus gordonii GN=gtf1 PE=3 SV=2 203 310 1.0E-07
sp|Q65CC7|KANE_STRKN Alpha-D-kanosaminyltransferase OS=Streptomyces kanamyceticus GN=kanE PE=1 SV=1 24 324 2.0E-07
sp|C8XA09|MSHA_NAKMY D-inositol 3-phosphate glycosyltransferase OS=Nakamurella multipartita (strain ATCC 700099 / DSM 44233 / JCM 9543 / Y-104) GN=mshA PE=3 SV=1 16 320 2.0E-07
sp|Q8NNK8|PIMB_CORGL GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pimB PE=1 SV=1 190 324 2.0E-07
sp|Q8FSH1|MSHA_COREF D-inositol 3-phosphate glycosyltransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=mshA PE=3 SV=1 4 369 2.0E-07
sp|Q3S2Y2|GTF1_STRAG Glycosyltransferase Gtf1 OS=Streptococcus agalactiae GN=gtf1 PE=1 SV=1 133 317 6.0E-07
sp|Q58459|Y1059_METJA Uncharacterized glycosyltransferase MJ1059 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1059 PE=3 SV=1 182 324 7.0E-07
sp|D7AW65|MSHA_NOCDD D-inositol 3-phosphate glycosyltransferase OS=Nocardiopsis dassonvillei (strain ATCC 23218 / DSM 43111 / IMRU 509 / JCM 7437 / NCTC 10488) GN=mshA PE=3 SV=1 16 320 1.0E-06
sp|P9WMZ5|PIMA_MYCTU GDP-mannose-dependent alpha-(1-2)-phosphatidylinositol mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pimA PE=1 SV=1 190 387 2.0E-06
sp|P9WMZ4|PIMA_MYCTO GDP-mannose-dependent alpha-(1-2)-phosphatidylinositol mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pimA PE=3 SV=1 190 387 2.0E-06
sp|Q7TY88|PIMA_MYCBO GDP-mannose-dependent alpha-(1-2)-phosphatidylinositol mannosyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pimA PE=3 SV=1 190 387 2.0E-06
sp|P9WMY5|MGTA_MYCTU GDP-mannose-dependent alpha-mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mgtA PE=1 SV=1 6 330 2.0E-06
sp|P9WMY4|MGTA_MYCTO GDP-mannose-dependent alpha-mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mgtA PE=3 SV=1 6 330 2.0E-06
sp|A3PU84|MSHA_MYCSJ D-inositol 3-phosphate glycosyltransferase OS=Mycobacterium sp. (strain JLS) GN=mshA PE=3 SV=1 16 339 3.0E-06
sp|Q58577|Y1178_METJA Uncharacterized glycosyltransferase MJ1178 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1178 PE=3 SV=1 86 381 5.0E-06
sp|Q9L1I4|Y2592_STRCO Exopolysaccharide phosphotransferase SCO2592 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO2592 PE=3 SV=1 189 385 9.0E-06
sp|P54138|MSHA_MYCLE D-inositol 3-phosphate glycosyltransferase OS=Mycobacterium leprae (strain TN) GN=mshA PE=3 SV=2 16 321 9.0E-06
sp|B8ZT88|MSHA_MYCLB D-inositol 3-phosphate glycosyltransferase OS=Mycobacterium leprae (strain Br4923) GN=mshA PE=3 SV=1 16 321 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0006506 GPI anchor biosynthetic process Yes
GO:0008152 metabolic process No
GO:0043412 macromolecule modification No
GO:1901576 organic substance biosynthetic process No
GO:0046486 glycerolipid metabolic process No
GO:0008654 phospholipid biosynthetic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0019538 protein metabolic process No
GO:0009247 glycolipid biosynthetic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0006793 phosphorus metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006497 protein lipidation No
GO:0044255 cellular lipid metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0009058 biosynthetic process No
GO:0045017 glycerolipid biosynthetic process No
GO:0006664 glycolipid metabolic process No
GO:1903509 liposaccharide metabolic process No
GO:0046474 glycerophospholipid biosynthetic process No
GO:0003674 molecular_function No
GO:0044249 cellular biosynthetic process No
GO:0006629 lipid metabolic process No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0046467 membrane lipid biosynthetic process No
GO:0008610 lipid biosynthetic process No
GO:0009987 cellular process No
GO:0006644 phospholipid metabolic process No
GO:0044238 primary metabolic process No
GO:0036211 protein modification process No
GO:0090407 organophosphate biosynthetic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0006643 membrane lipid metabolic process No
GO:0016740 transferase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0006650 glycerophospholipid metabolic process No
GO:0046488 phosphatidylinositol metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006661 phosphatidylinositol biosynthetic process No
GO:0006505 GPI anchor metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 406 428 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|016820
MERLAIAMISDFFHPNVGGVENHIYMLSTELIRRGHKVIVITHAHKPDRVGIRWLLPSLKVYYIPFIPIASSATL
PNFFTSLPYLRTILLREHIHLIHAHASLSSIGHEGILHSHLMGIRTVFTDHSLFGFEDAASILTNKLLVATLKNV
DAVICVSHTGRENTVLRGQLFEKDQNDSTKLSVRRSVYVIPNALVAEQFKPRPPEPSEFITIVVISRLAYRKGID
LLVATAPRICAAFPNVRFVVGGDGPKLIDLLQMREKHLLQDRVELLGAIRHSDVLSVLSRGTIFMNTSLTESFGI
AILEAACAGLYVVSTRVGGVPEILPQDMISFAEPDADDVYRAISEAITLVAAGKHDPMKAHERLKTFYDWRLVAA
RTEKVYTAVVQSPQMGLVERIQRTMDLGPCVGPIYTIILLVDCIFFLVLEWFYPREDLDYVEHHWDDDALTQLQS
LSYSRES*
Coding >AgabiH97|016820
ATGGAGAGGCTTGCAATTGCTATGATATCGGACTTCTTTCATCCCAATGTTGGAGGTGTAGAGAACCACATTTAC
ATGCTAAGTACGGAGTTGATAAGACGTGGTCACAAGGTTATAGTGATAACCCACGCACATAAACCAGACCGCGTC
GGTATTCGCTGGCTTCTTCCATCTCTCAAAGTCTACTATATACCCTTTATACCCATTGCATCCTCGGCCACACTC
CCAAATTTCTTCACTTCACTACCGTATCTTAGAACCATCCTCTTACGCGAACACATACACTTAATTCATGCTCAT
GCCAGCTTATCCTCGATTGGACATGAAGGCATTCTACATTCGCACCTCATGGGTATTCGGACAGTCTTCACTGAT
CACAGTCTCTTCGGCTTCGAAGATGCGGCAAGTATTTTGACCAACAAACTTCTTGTCGCTACTCTCAAAAACGTG
GATGCGGTCATCTGTGTCTCACATACCGGGCGGGAAAATACTGTTCTACGAGGGCAACTATTCGAGAAAGACCAA
AACGATTCTACCAAGCTCTCTGTTCGACGAAGTGTTTACGTAATCCCTAATGCGCTCGTCGCGGAGCAATTCAAG
CCACGCCCGCCAGAGCCTAGCGAATTCATCACTATTGTCGTTATCTCCAGGCTCGCCTATCGAAAAGGTATCGAC
TTACTTGTAGCAACTGCTCCTCGTATTTGCGCCGCATTTCCCAATGTAAGATTCGTCGTTGGCGGTGATGGTCCC
AAGTTGATTGATCTTCTCCAGATGCGCGAAAAACATTTATTGCAAGATCGTGTCGAATTACTAGGCGCAATACGT
CATAGTGATGTCCTTTCGGTCTTGTCCCGCGGTACAATATTCATGAACACATCCTTGACAGAATCATTTGGCATA
GCCATTCTCGAAGCTGCCTGTGCCGGTTTATACGTCGTATCTACTCGGGTCGGAGGAGTACCAGAAATTTTACCA
CAAGACATGATCAGTTTTGCTGAGCCAGATGCAGATGACGTCTACCGTGCTATCTCAGAAGCCATTACACTGGTC
GCAGCAGGAAAACATGACCCGATGAAAGCACACGAACGCCTAAAAACTTTTTATGATTGGCGCTTGGTTGCCGCA
AGGACTGAAAAAGTATACACCGCCGTCGTTCAGTCGCCTCAAATGGGATTGGTGGAACGCATTCAAAGGACAATG
GATTTAGGTCCTTGTGTAGGACCCATATATACGATAATCCTGTTAGTTGATTGCATATTCTTCTTGGTGTTGGAA
TGGTTTTATCCAAGAGAGGACCTGGATTACGTAGAACATCATTGGGATGATGATGCACTTACCCAGCTTCAGTCC
CTGTCGTATAGTAGGGAGAGTTAA
Transcript >AgabiH97|016820
ATGGAGAGGCTTGCAATTGCTATGATATCGGACTTCTTTCATCCCAATGTTGGAGGTGTAGAGAACCACATTTAC
ATGCTAAGTACGGAGTTGATAAGACGTGGTCACAAGGTTATAGTGATAACCCACGCACATAAACCAGACCGCGTC
GGTATTCGCTGGCTTCTTCCATCTCTCAAAGTCTACTATATACCCTTTATACCCATTGCATCCTCGGCCACACTC
CCAAATTTCTTCACTTCACTACCGTATCTTAGAACCATCCTCTTACGCGAACACATACACTTAATTCATGCTCAT
GCCAGCTTATCCTCGATTGGACATGAAGGCATTCTACATTCGCACCTCATGGGTATTCGGACAGTCTTCACTGAT
CACAGTCTCTTCGGCTTCGAAGATGCGGCAAGTATTTTGACCAACAAACTTCTTGTCGCTACTCTCAAAAACGTG
GATGCGGTCATCTGTGTCTCACATACCGGGCGGGAAAATACTGTTCTACGAGGGCAACTATTCGAGAAAGACCAA
AACGATTCTACCAAGCTCTCTGTTCGACGAAGTGTTTACGTAATCCCTAATGCGCTCGTCGCGGAGCAATTCAAG
CCACGCCCGCCAGAGCCTAGCGAATTCATCACTATTGTCGTTATCTCCAGGCTCGCCTATCGAAAAGGTATCGAC
TTACTTGTAGCAACTGCTCCTCGTATTTGCGCCGCATTTCCCAATGTAAGATTCGTCGTTGGCGGTGATGGTCCC
AAGTTGATTGATCTTCTCCAGATGCGCGAAAAACATTTATTGCAAGATCGTGTCGAATTACTAGGCGCAATACGT
CATAGTGATGTCCTTTCGGTCTTGTCCCGCGGTACAATATTCATGAACACATCCTTGACAGAATCATTTGGCATA
GCCATTCTCGAAGCTGCCTGTGCCGGTTTATACGTCGTATCTACTCGGGTCGGAGGAGTACCAGAAATTTTACCA
CAAGACATGATCAGTTTTGCTGAGCCAGATGCAGATGACGTCTACCGTGCTATCTCAGAAGCCATTACACTGGTC
GCAGCAGGAAAACATGACCCGATGAAAGCACACGAACGCCTAAAAACTTTTTATGATTGGCGCTTGGTTGCCGCA
AGGACTGAAAAAGTATACACCGCCGTCGTTCAGTCGCCTCAAATGGGATTGGTGGAACGCATTCAAAGGACAATG
GATTTAGGTCCTTGTGTAGGACCCATATATACGATAATCCTGTTAGTTGATTGCATATTCTTCTTGGTGTTGGAA
TGGTTTTATCCAAGAGAGGACCTGGATTACGTAGAACATCATTGGGATGATGATGCACTTACCCAGCTTCAGTCC
CTGTCGTATAGTAGGGAGAGTTAA
Gene >AgabiH97|016820
ATGGAGAGGCTTGCAATTGCGTACGTGCCAACCTTTTTTACAATGACGTGTAGCTTACATGGAGACTGTCAGTAT
GATATCGGACTTCTTTCATCCCAATGTTGGAGGTGTAGAGAACCACATTTACATGCTAAGTACGGAGTTGATAAG
ACGTGGTCACAAGGTACGTTTTGCACTCATTTAGGACAAAAGTTCGCATATCTGAGGTGGACCTACACAAAGGTT
ATAGTGATAACCCACGCACATAAACCAGACCGCGTCGGTATTCGCTGGCTTCTTCCATCTCTCAAAGTCTACTAT
ATACCCTTTATACCCATTGCATCCTCGGCCACACTCCCAAATTTCTTCACTTCACTACCGTATCTTAGAACCATC
CTCTTACGCGAACACATACACTTAATTCATGCTCATGCCAGCTTATCCTCGATTGGACATGAAGGCATTCTACAT
TCGCACCTCATGGGTATTCGGACAGTCTTCACTGATCACAGTCTCTTCGGCTTCGAAGATGCGGCAAGTATTTTG
ACCAACAAACTTCTTGTCGCTACTCTCAAAAACGTGGATGCGGTCATCTGTGTCTCACATACCGGGTTCGTACTC
GCTCATTGCGTATTGCATCAGCTAAATAGTATATACAGGCGGGAAAATACTGTTCTACGAGGGCAACTATTCGAG
AAAGACCAAAACGATTCTACCAAGCTCTCTGTTCGACGAAGTGTTTACGTAATCCCTAATGCGCTCGTCGCGGAG
CAATTCAAGCCACGCCCGCCAGAGCCTAGCGAATTCAGTGCATTTATCCGCGCCTTACGATAGGGGATATGAATG
ACTAATATTCATTTTCAGTCACTATTGTCGTTATCTCCAGGCTCGCCTATCGAAAAGGTATCGACTTACTTGTAG
CAACTGCTCCTCGTATTTGCGCCGCATTTCCCAATGTAAGATTCGTCGTTGGTACGTCGCCTTCCCGCCAAACGA
TGGAAATCTTGAGTTCACAGAAAGTCTAACAAAACGATAGGCGGTGATGGTCCCAAGTTGATTGATCTTCTCCAG
ATGCGCGAAAAACATTTATTGCAAGATCGTGTCGAATTACTAGGCGCAATACGTCATAGTGATGTCCTTTCGGTG
AGTAAACCCATCGAAATTCACTTCTCAACTTAACTCAAAATTCTGAGCAATAGGTCTTGTCCCGCGGTACAATAT
TCATGAACACATCCTTGACAGAATCATTTGGCATAGCCATTCTCGAAGCTGCCTGTGCCGGTTTATACGTCGTAT
CTACTCGGGTCGGAGGAGTACCAGAAATTTTACCACAAGACATGATCAGTTTTGCTGAGCCAGATGCAGATGGTA
TGTATATGGTCCCTTTCTCATATAAGACTGTATTGCATCAATATAGCTTCATGAGTTACGGGACCCATGAGCATG
GGACTACGAAAACTGATTTAGCGAAATTTTTTTCTTTTCTTCCTGACAGACGTCTACCGTGCTATCTCAGAAGCC
ATTACACTGGTCGCAGCAGGAAAACATGACCCGATGAAAGCACACGAACGCCTAAAAACTTTTTATGATTGGCGC
TTGGTTGCCGCAAGGACTGAAAAAGTATACACCGCCGTCGTTCAGTCGCCTCAAATGGGATTGGTGGAACGCATT
CAAAGGTACGTCGAGATGGTTTGTGTCGTGGCGGAAAATTAATTTCCATTAGGACAATGGATTTAGGTCCTTGTG
TAGGACCCATATATACGATAATCCTGTTAGTTGATTGCATATTCTTCTTGGTGTTGGAATGGTTTTATCCAAGAG
AGGACCTGGATTACGTAGAACATCATTGGGATGATGATGCACTTACCCAGCTTCAGTCCCTGTCGTATAGTAGGG
AGAGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail