Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|016530
Gene name
Locationscaffold_10:432166..435502
Strand-
Gene length (bp)3336
Transcript length (bp)3336
Coding sequence length (bp)3336
Protein length (aa) 1112

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07727 RVT_2 Reverse transcriptase (RNA-dependent DNA polymerase) 1.1E-36 933 1106
PF13976 gag_pre-integrs GAG-pre-integrase domain 2.3E-12 468 541
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 6.3E-08 91 207

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 14 1102 2.0E-99
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 169 784 4.0E-45
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 903 1105 2.0E-26
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 420 751 5.0E-22
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 420 751 7.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 14 1102 2.0E-99
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 169 784 4.0E-45
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 903 1105 2.0E-26
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 420 751 5.0E-22
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 420 751 7.0E-22
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 420 751 7.0E-22
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 420 751 8.0E-22
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 421 751 8.0E-22
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 421 751 8.0E-22
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 420 751 9.0E-22
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 420 751 9.0E-22
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 420 751 9.0E-22
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 420 751 9.0E-22
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 420 751 9.0E-22
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 420 751 1.0E-21
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 420 751 1.0E-21
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 420 751 1.0E-21
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 421 751 2.0E-21
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 421 751 2.0E-21
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 421 751 2.0E-21
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 421 751 2.0E-21
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 421 751 2.0E-21
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 421 751 2.0E-21
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 421 751 3.0E-21
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 421 751 3.0E-21
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 421 751 3.0E-21
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 421 751 3.0E-21
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 421 751 3.0E-21
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 421 751 3.0E-21
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 421 751 3.0E-21
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 421 751 3.0E-21
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 421 751 3.0E-21
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 421 751 3.0E-21
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 421 751 3.0E-21
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 421 751 3.0E-21
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 421 751 3.0E-21
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 421 751 4.0E-21
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 421 751 4.0E-21
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 421 751 4.0E-21
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 421 751 4.0E-21
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 421 751 4.0E-21
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 421 751 4.0E-21
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 421 751 5.0E-21
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 421 751 5.0E-21
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 421 751 5.0E-21
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 421 751 5.0E-21
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 421 751 2.0E-20
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 533 751 3.0E-15
sp|P92520|M820_ARATH Uncharacterized mitochondrial protein AtMg00820 OS=Arabidopsis thaliana GN=AtMg00820 PE=4 SV=1 876 1005 1.0E-13
sp|A0A0B7P3V8|YP41B_YEAST Transposon Ty4-P Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-P PE=5 SV=2 355 746 1.0E-13
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 355 746 2.0E-13
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 355 746 2.0E-13
sp|P92512|M710_ARATH Uncharacterized mitochondrial protein AtMg00710 OS=Arabidopsis thaliana GN=AtMg00710 PE=4 SV=1 668 752 4.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|016530
MASTGGSPPPIFADAAKFNGSNWVTWKGLVRIAADLRGVYGYLDGSIPNPAPVNPVNVPIPTTPPTTTPPTIITP
TSETPWESITPSTSEWRVRNAWAMGLLIYNTSDPVGLGINIHGTAPDAWRSYTDTYEVASEIAILNAELTLRNAT
YVDGQDFIEFITQMRTKWSNATALGAPIDDKSFRTIILNALPRSWDPIVATLYTTQSSWDAINQLMTHWARISRE
HVVNPSTTTSALQTSTQRPNRERRTQSQLQCSNSNCGRRGHTIDDCYWPGGGKAGQFPPGFGKRGGNRGSATTGN
STQQTTVNAVATEGNNGSSEPQVFALAAISEIEELSDKPQCVPQSYAVLSPNPILTLLDSGASDHCFVDRGSFSQ
YQEILPPRTGHSAGKDSTFEIKGTGIAEFLTVTGGSLSKIMLNASLHTPLLRSNLISVSKLVSKGAKISFEGDTA
IVYNTQGNTVMTATRRDGLYVVDTRNTRTPVLNATQSKRKSVPYEVWHRRLGHISTDVILRMHRENLVDGLDAHG
GAEMKALCEDCIFGKHTTHPFSDTAPAEVDVLDRIYIDLWGPAPVVSAGGAKYFMLLMDRASSYRRVYFLPSKSA
ETTLQVFKEFHRESERQTGRKLKHVRLDMGREWHNELWDTYVKENGILLDFTTPYAHQQNGKAERSMRTLLEMAQ
TMLSDAGLPQMYWADAVQTAVYTRNLVPPTRSPTIIPAEHWLQKWQDVSHLRPFGSIAYAHIPVEISPSKLSPRS
VKLTFIGYFDRAGYKLLDRATGKIHKSRDVIFEERAPHYLTDPVITYPLDYTLTTPDLTAVAPRPKPINTLHPAT
PIPATTPGKDTSQDDDGRLDSEGEVAGLLKEKVDDTPALQRSRREIVPSRRMKESLEYLNRAKANVAVSDSVHDE
AYVPKTFTDAMNRPDLWFEPMLKELQAMRDKGVYRLVPRPADKNVVKSRWVFATKYDDAGNISGHKARLVAKGFT
QVLGEDYDETYASVARLESVRLVCAISASMGLRLWQVDFVSAFLNSDNSFEVYMEQPAGFEEGGGGYVWLLLKTL
YGTMQGAHDWARNLQNTYQGHSYYTSKADPQVRSRVEGDEITLTSTWTDDILGASSTEAVL*
Coding >AgabiH97|016530
ATGGCCAGCACTGGCGGAAGTCCCCCACCTATCTTCGCCGATGCGGCGAAGTTTAACGGCTCCAATTGGGTAACA
TGGAAAGGCCTGGTTAGAATTGCAGCCGACCTTCGTGGCGTTTACGGATACCTTGATGGATCGATTCCAAATCCC
GCACCAGTTAATCCTGTGAACGTACCTATCCCAACCACACCACCTACTACTACGCCACCTACTATCATCACTCCA
ACATCAGAAACTCCTTGGGAATCTATCACCCCATCTACGTCCGAATGGAGAGTCCGCAACGCGTGGGCTATGGGC
CTTCTCATCTACAACACTAGCGACCCGGTTGGACTCGGAATTAATATTCATGGGACAGCCCCAGACGCCTGGAGG
TCCTACACCGATACATACGAAGTAGCATCAGAAATTGCTATCTTAAATGCAGAGCTCACCTTGCGAAACGCCACC
TATGTCGATGGCCAGGACTTCATCGAATTTATCACCCAGATGAGGACCAAGTGGTCGAATGCTACCGCTCTTGGA
GCACCTATCGACGATAAATCCTTCCGCACAATCATCTTAAACGCGTTGCCAAGATCCTGGGACCCTATCGTCGCT
ACACTATACACCACCCAATCGTCCTGGGATGCTATCAACCAACTCATGACCCACTGGGCACGTATCAGCAGAGAA
CATGTCGTTAACCCTAGTACAACCACATCAGCACTCCAAACTTCGACGCAGAGACCTAACCGTGAAAGGCGTACC
CAAAGCCAACTCCAATGCTCTAACTCCAACTGTGGTCGACGAGGACATACTATAGATGATTGCTACTGGCCAGGT
GGCGGAAAAGCAGGCCAATTCCCACCAGGCTTCGGCAAACGTGGAGGAAATAGAGGTTCGGCAACTACAGGCAAC
TCAACGCAGCAAACTACTGTGAACGCTGTAGCAACTGAGGGAAATAATGGTTCGTCTGAACCACAGGTTTTCGCT
CTTGCAGCTATTAGTGAGATCGAGGAACTATCTGACAAACCCCAATGTGTACCTCAATCCTATGCTGTCCTCTCG
CCCAACCCAATCCTTACTTTGCTTGACTCAGGAGCCAGCGACCACTGTTTTGTCGACCGTGGAAGTTTCTCCCAA
TATCAAGAGATCCTTCCCCCGCGCACCGGGCACTCGGCAGGCAAAGATTCTACCTTCGAGATCAAAGGAACGGGG
ATTGCTGAGTTCTTGACTGTAACGGGAGGATCGTTGTCGAAAATAATGCTCAATGCCTCCCTCCACACGCCACTC
TTGAGATCCAATTTGATATCCGTATCGAAACTTGTGTCTAAAGGAGCAAAGATCAGTTTCGAAGGAGATACAGCT
ATCGTATACAACACACAGGGCAATACCGTCATGACGGCCACCAGGAGAGATGGACTTTATGTCGTTGATACACGG
AACACACGCACACCGGTCCTGAACGCTACGCAAAGTAAAAGGAAGTCAGTGCCATACGAGGTCTGGCATAGACGT
CTCGGTCATATCTCCACTGACGTTATTCTTCGTATGCATCGAGAGAACTTGGTTGACGGTCTTGATGCACATGGG
GGAGCTGAGATGAAGGCGTTATGTGAGGATTGTATCTTTGGGAAGCATACAACGCACCCTTTTAGTGATACAGCG
CCGGCGGAGGTTGACGTTCTCGACAGGATTTACATCGATCTGTGGGGACCAGCACCTGTAGTCTCTGCAGGCGGA
GCGAAGTACTTCATGCTGTTGATGGACAGAGCGTCTTCATACCGAAGGGTCTATTTCTTGCCGTCAAAGTCGGCG
GAGACTACGTTGCAGGTCTTCAAGGAGTTTCACAGGGAATCGGAACGGCAGACTGGGCGGAAGTTGAAGCATGTA
CGTCTGGACATGGGCCGTGAGTGGCATAACGAGCTGTGGGACACCTATGTGAAGGAAAATGGCATACTTCTGGAC
TTCACGACCCCATACGCTCATCAACAGAACGGCAAAGCGGAGCGTAGTATGCGTACGCTGCTGGAGATGGCTCAA
ACTATGCTGTCCGATGCTGGTCTGCCACAAATGTATTGGGCCGACGCAGTGCAGACGGCAGTCTACACTCGAAAT
CTTGTTCCTCCTACTCGCAGCCCGACGATTATCCCCGCTGAACACTGGTTACAGAAATGGCAGGATGTGTCTCAT
TTACGCCCGTTTGGATCCATTGCATATGCGCATATACCTGTTGAGATTAGTCCCTCGAAGTTATCTCCCAGATCC
GTGAAACTCACCTTCATTGGCTACTTCGACCGTGCGGGCTATAAGCTCCTGGACCGTGCTACTGGTAAGATTCAC
AAGTCGAGGGATGTCATTTTCGAGGAGAGAGCTCCACATTACTTGACAGACCCCGTTATTACGTATCCTTTGGAC
TACACCCTAACCACGCCGGACCTTACCGCTGTGGCGCCACGCCCTAAGCCGATTAACACCCTTCATCCCGCTACA
CCAATCCCTGCTACGACCCCCGGTAAAGATACCTCTCAAGACGATGACGGACGACTTGATAGTGAGGGTGAGGTT
GCGGGGTTACTCAAGGAGAAGGTGGATGACACCCCTGCCCTACAGAGGTCGAGACGAGAGATTGTTCCTAGTCGT
AGGATGAAGGAGAGTCTCGAGTATCTTAACCGGGCTAAAGCTAACGTCGCGGTGAGCGATAGCGTCCATGATGAG
GCTTATGTGCCAAAGACTTTTACGGACGCGATGAACCGGCCGGATTTATGGTTTGAGCCTATGCTGAAGGAATTA
CAGGCGATGCGCGACAAAGGCGTCTACAGGCTAGTGCCCCGACCAGCTGACAAGAATGTCGTGAAGTCTCGATGG
GTATTCGCCACCAAGTACGACGATGCGGGTAATATCTCCGGCCACAAAGCTCGCCTAGTTGCAAAAGGCTTTACT
CAGGTACTGGGTGAAGACTACGACGAGACTTATGCCTCTGTCGCTCGCCTGGAGTCAGTTCGCCTCGTCTGCGCT
ATCTCTGCTTCTATGGGACTTCGACTGTGGCAGGTCGATTTTGTCTCTGCTTTCCTGAATAGCGACAATTCTTTT
GAGGTGTATATGGAGCAGCCGGCTGGTTTTGAGGAAGGGGGGGGTGGATACGTATGGCTCCTTCTCAAAACTCTC
TACGGCACCATGCAAGGCGCTCATGACTGGGCACGCAACCTCCAGAACACCTACCAAGGCCACAGTTATTACACC
TCCAAGGCAGATCCTCAAGTGCGATCCCGTGTCGAAGGTGACGAAATTACGCTTACTTCGACGTGGACTGACGAC
ATTCTGGGTGCATCCTCGACTGAGGCAGTGTTATGA
Transcript >AgabiH97|016530
ATGGCCAGCACTGGCGGAAGTCCCCCACCTATCTTCGCCGATGCGGCGAAGTTTAACGGCTCCAATTGGGTAACA
TGGAAAGGCCTGGTTAGAATTGCAGCCGACCTTCGTGGCGTTTACGGATACCTTGATGGATCGATTCCAAATCCC
GCACCAGTTAATCCTGTGAACGTACCTATCCCAACCACACCACCTACTACTACGCCACCTACTATCATCACTCCA
ACATCAGAAACTCCTTGGGAATCTATCACCCCATCTACGTCCGAATGGAGAGTCCGCAACGCGTGGGCTATGGGC
CTTCTCATCTACAACACTAGCGACCCGGTTGGACTCGGAATTAATATTCATGGGACAGCCCCAGACGCCTGGAGG
TCCTACACCGATACATACGAAGTAGCATCAGAAATTGCTATCTTAAATGCAGAGCTCACCTTGCGAAACGCCACC
TATGTCGATGGCCAGGACTTCATCGAATTTATCACCCAGATGAGGACCAAGTGGTCGAATGCTACCGCTCTTGGA
GCACCTATCGACGATAAATCCTTCCGCACAATCATCTTAAACGCGTTGCCAAGATCCTGGGACCCTATCGTCGCT
ACACTATACACCACCCAATCGTCCTGGGATGCTATCAACCAACTCATGACCCACTGGGCACGTATCAGCAGAGAA
CATGTCGTTAACCCTAGTACAACCACATCAGCACTCCAAACTTCGACGCAGAGACCTAACCGTGAAAGGCGTACC
CAAAGCCAACTCCAATGCTCTAACTCCAACTGTGGTCGACGAGGACATACTATAGATGATTGCTACTGGCCAGGT
GGCGGAAAAGCAGGCCAATTCCCACCAGGCTTCGGCAAACGTGGAGGAAATAGAGGTTCGGCAACTACAGGCAAC
TCAACGCAGCAAACTACTGTGAACGCTGTAGCAACTGAGGGAAATAATGGTTCGTCTGAACCACAGGTTTTCGCT
CTTGCAGCTATTAGTGAGATCGAGGAACTATCTGACAAACCCCAATGTGTACCTCAATCCTATGCTGTCCTCTCG
CCCAACCCAATCCTTACTTTGCTTGACTCAGGAGCCAGCGACCACTGTTTTGTCGACCGTGGAAGTTTCTCCCAA
TATCAAGAGATCCTTCCCCCGCGCACCGGGCACTCGGCAGGCAAAGATTCTACCTTCGAGATCAAAGGAACGGGG
ATTGCTGAGTTCTTGACTGTAACGGGAGGATCGTTGTCGAAAATAATGCTCAATGCCTCCCTCCACACGCCACTC
TTGAGATCCAATTTGATATCCGTATCGAAACTTGTGTCTAAAGGAGCAAAGATCAGTTTCGAAGGAGATACAGCT
ATCGTATACAACACACAGGGCAATACCGTCATGACGGCCACCAGGAGAGATGGACTTTATGTCGTTGATACACGG
AACACACGCACACCGGTCCTGAACGCTACGCAAAGTAAAAGGAAGTCAGTGCCATACGAGGTCTGGCATAGACGT
CTCGGTCATATCTCCACTGACGTTATTCTTCGTATGCATCGAGAGAACTTGGTTGACGGTCTTGATGCACATGGG
GGAGCTGAGATGAAGGCGTTATGTGAGGATTGTATCTTTGGGAAGCATACAACGCACCCTTTTAGTGATACAGCG
CCGGCGGAGGTTGACGTTCTCGACAGGATTTACATCGATCTGTGGGGACCAGCACCTGTAGTCTCTGCAGGCGGA
GCGAAGTACTTCATGCTGTTGATGGACAGAGCGTCTTCATACCGAAGGGTCTATTTCTTGCCGTCAAAGTCGGCG
GAGACTACGTTGCAGGTCTTCAAGGAGTTTCACAGGGAATCGGAACGGCAGACTGGGCGGAAGTTGAAGCATGTA
CGTCTGGACATGGGCCGTGAGTGGCATAACGAGCTGTGGGACACCTATGTGAAGGAAAATGGCATACTTCTGGAC
TTCACGACCCCATACGCTCATCAACAGAACGGCAAAGCGGAGCGTAGTATGCGTACGCTGCTGGAGATGGCTCAA
ACTATGCTGTCCGATGCTGGTCTGCCACAAATGTATTGGGCCGACGCAGTGCAGACGGCAGTCTACACTCGAAAT
CTTGTTCCTCCTACTCGCAGCCCGACGATTATCCCCGCTGAACACTGGTTACAGAAATGGCAGGATGTGTCTCAT
TTACGCCCGTTTGGATCCATTGCATATGCGCATATACCTGTTGAGATTAGTCCCTCGAAGTTATCTCCCAGATCC
GTGAAACTCACCTTCATTGGCTACTTCGACCGTGCGGGCTATAAGCTCCTGGACCGTGCTACTGGTAAGATTCAC
AAGTCGAGGGATGTCATTTTCGAGGAGAGAGCTCCACATTACTTGACAGACCCCGTTATTACGTATCCTTTGGAC
TACACCCTAACCACGCCGGACCTTACCGCTGTGGCGCCACGCCCTAAGCCGATTAACACCCTTCATCCCGCTACA
CCAATCCCTGCTACGACCCCCGGTAAAGATACCTCTCAAGACGATGACGGACGACTTGATAGTGAGGGTGAGGTT
GCGGGGTTACTCAAGGAGAAGGTGGATGACACCCCTGCCCTACAGAGGTCGAGACGAGAGATTGTTCCTAGTCGT
AGGATGAAGGAGAGTCTCGAGTATCTTAACCGGGCTAAAGCTAACGTCGCGGTGAGCGATAGCGTCCATGATGAG
GCTTATGTGCCAAAGACTTTTACGGACGCGATGAACCGGCCGGATTTATGGTTTGAGCCTATGCTGAAGGAATTA
CAGGCGATGCGCGACAAAGGCGTCTACAGGCTAGTGCCCCGACCAGCTGACAAGAATGTCGTGAAGTCTCGATGG
GTATTCGCCACCAAGTACGACGATGCGGGTAATATCTCCGGCCACAAAGCTCGCCTAGTTGCAAAAGGCTTTACT
CAGGTACTGGGTGAAGACTACGACGAGACTTATGCCTCTGTCGCTCGCCTGGAGTCAGTTCGCCTCGTCTGCGCT
ATCTCTGCTTCTATGGGACTTCGACTGTGGCAGGTCGATTTTGTCTCTGCTTTCCTGAATAGCGACAATTCTTTT
GAGGTGTATATGGAGCAGCCGGCTGGTTTTGAGGAAGGGGGGGGTGGATACGTATGGCTCCTTCTCAAAACTCTC
TACGGCACCATGCAAGGCGCTCATGACTGGGCACGCAACCTCCAGAACACCTACCAAGGCCACAGTTATTACACC
TCCAAGGCAGATCCTCAAGTGCGATCCCGTGTCGAAGGTGACGAAATTACGCTTACTTCGACGTGGACTGACGAC
ATTCTGGGTGCATCCTCGACTGAGGCAGTGTTATGA
Gene >AgabiH97|016530
ATGGCCAGCACTGGCGGAAGTCCCCCACCTATCTTCGCCGATGCGGCGAAGTTTAACGGCTCCAATTGGGTAACA
TGGAAAGGCCTGGTTAGAATTGCAGCCGACCTTCGTGGCGTTTACGGATACCTTGATGGATCGATTCCAAATCCC
GCACCAGTTAATCCTGTGAACGTACCTATCCCAACCACACCACCTACTACTACGCCACCTACTATCATCACTCCA
ACATCAGAAACTCCTTGGGAATCTATCACCCCATCTACGTCCGAATGGAGAGTCCGCAACGCGTGGGCTATGGGC
CTTCTCATCTACAACACTAGCGACCCGGTTGGACTCGGAATTAATATTCATGGGACAGCCCCAGACGCCTGGAGG
TCCTACACCGATACATACGAAGTAGCATCAGAAATTGCTATCTTAAATGCAGAGCTCACCTTGCGAAACGCCACC
TATGTCGATGGCCAGGACTTCATCGAATTTATCACCCAGATGAGGACCAAGTGGTCGAATGCTACCGCTCTTGGA
GCACCTATCGACGATAAATCCTTCCGCACAATCATCTTAAACGCGTTGCCAAGATCCTGGGACCCTATCGTCGCT
ACACTATACACCACCCAATCGTCCTGGGATGCTATCAACCAACTCATGACCCACTGGGCACGTATCAGCAGAGAA
CATGTCGTTAACCCTAGTACAACCACATCAGCACTCCAAACTTCGACGCAGAGACCTAACCGTGAAAGGCGTACC
CAAAGCCAACTCCAATGCTCTAACTCCAACTGTGGTCGACGAGGACATACTATAGATGATTGCTACTGGCCAGGT
GGCGGAAAAGCAGGCCAATTCCCACCAGGCTTCGGCAAACGTGGAGGAAATAGAGGTTCGGCAACTACAGGCAAC
TCAACGCAGCAAACTACTGTGAACGCTGTAGCAACTGAGGGAAATAATGGTTCGTCTGAACCACAGGTTTTCGCT
CTTGCAGCTATTAGTGAGATCGAGGAACTATCTGACAAACCCCAATGTGTACCTCAATCCTATGCTGTCCTCTCG
CCCAACCCAATCCTTACTTTGCTTGACTCAGGAGCCAGCGACCACTGTTTTGTCGACCGTGGAAGTTTCTCCCAA
TATCAAGAGATCCTTCCCCCGCGCACCGGGCACTCGGCAGGCAAAGATTCTACCTTCGAGATCAAAGGAACGGGG
ATTGCTGAGTTCTTGACTGTAACGGGAGGATCGTTGTCGAAAATAATGCTCAATGCCTCCCTCCACACGCCACTC
TTGAGATCCAATTTGATATCCGTATCGAAACTTGTGTCTAAAGGAGCAAAGATCAGTTTCGAAGGAGATACAGCT
ATCGTATACAACACACAGGGCAATACCGTCATGACGGCCACCAGGAGAGATGGACTTTATGTCGTTGATACACGG
AACACACGCACACCGGTCCTGAACGCTACGCAAAGTAAAAGGAAGTCAGTGCCATACGAGGTCTGGCATAGACGT
CTCGGTCATATCTCCACTGACGTTATTCTTCGTATGCATCGAGAGAACTTGGTTGACGGTCTTGATGCACATGGG
GGAGCTGAGATGAAGGCGTTATGTGAGGATTGTATCTTTGGGAAGCATACAACGCACCCTTTTAGTGATACAGCG
CCGGCGGAGGTTGACGTTCTCGACAGGATTTACATCGATCTGTGGGGACCAGCACCTGTAGTCTCTGCAGGCGGA
GCGAAGTACTTCATGCTGTTGATGGACAGAGCGTCTTCATACCGAAGGGTCTATTTCTTGCCGTCAAAGTCGGCG
GAGACTACGTTGCAGGTCTTCAAGGAGTTTCACAGGGAATCGGAACGGCAGACTGGGCGGAAGTTGAAGCATGTA
CGTCTGGACATGGGCCGTGAGTGGCATAACGAGCTGTGGGACACCTATGTGAAGGAAAATGGCATACTTCTGGAC
TTCACGACCCCATACGCTCATCAACAGAACGGCAAAGCGGAGCGTAGTATGCGTACGCTGCTGGAGATGGCTCAA
ACTATGCTGTCCGATGCTGGTCTGCCACAAATGTATTGGGCCGACGCAGTGCAGACGGCAGTCTACACTCGAAAT
CTTGTTCCTCCTACTCGCAGCCCGACGATTATCCCCGCTGAACACTGGTTACAGAAATGGCAGGATGTGTCTCAT
TTACGCCCGTTTGGATCCATTGCATATGCGCATATACCTGTTGAGATTAGTCCCTCGAAGTTATCTCCCAGATCC
GTGAAACTCACCTTCATTGGCTACTTCGACCGTGCGGGCTATAAGCTCCTGGACCGTGCTACTGGTAAGATTCAC
AAGTCGAGGGATGTCATTTTCGAGGAGAGAGCTCCACATTACTTGACAGACCCCGTTATTACGTATCCTTTGGAC
TACACCCTAACCACGCCGGACCTTACCGCTGTGGCGCCACGCCCTAAGCCGATTAACACCCTTCATCCCGCTACA
CCAATCCCTGCTACGACCCCCGGTAAAGATACCTCTCAAGACGATGACGGACGACTTGATAGTGAGGGTGAGGTT
GCGGGGTTACTCAAGGAGAAGGTGGATGACACCCCTGCCCTACAGAGGTCGAGACGAGAGATTGTTCCTAGTCGT
AGGATGAAGGAGAGTCTCGAGTATCTTAACCGGGCTAAAGCTAACGTCGCGGTGAGCGATAGCGTCCATGATGAG
GCTTATGTGCCAAAGACTTTTACGGACGCGATGAACCGGCCGGATTTATGGTTTGAGCCTATGCTGAAGGAATTA
CAGGCGATGCGCGACAAAGGCGTCTACAGGCTAGTGCCCCGACCAGCTGACAAGAATGTCGTGAAGTCTCGATGG
GTATTCGCCACCAAGTACGACGATGCGGGTAATATCTCCGGCCACAAAGCTCGCCTAGTTGCAAAAGGCTTTACT
CAGGTACTGGGTGAAGACTACGACGAGACTTATGCCTCTGTCGCTCGCCTGGAGTCAGTTCGCCTCGTCTGCGCT
ATCTCTGCTTCTATGGGACTTCGACTGTGGCAGGTCGATTTTGTCTCTGCTTTCCTGAATAGCGACAATTCTTTT
GAGGTGTATATGGAGCAGCCGGCTGGTTTTGAGGAAGGGGGGGGTGGATACGTATGGCTCCTTCTCAAAACTCTC
TACGGCACCATGCAAGGCGCTCATGACTGGGCACGCAACCTCCAGAACACCTACCAAGGCCACAGTTATTACACC
TCCAAGGCAGATCCTCAAGTGCGATCCCGTGTCGAAGGTGACGAAATTACGCTTACTTCGACGTGGACTGACGAC
ATTCTGGGTGCATCCTCGACTGAGGCAGTGTTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail